KEGG   Saccharomyces cerevisiae (budding yeast): YDR510WHelp
Entry
YDR510W           CDS       T00005                                 

Gene name
SMT3
Definition
SUMO family protein SMT3
Orthology
K12160  
small ubiquitin-related modifier
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:sce03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:1469400..1469705
Genome map
AA seq 101 aa AA seqDB search
MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEM
DSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtcggactcagaagtcaatcaagaagctaagccagaggtcaagccagaagtcaagcct
gagactcacatcaatttaaaggtgtccgatggatcttcagagatcttcttcaagatcaaa
aagaccactcctttaagaaggctgatggaagcgttcgctaaaagacagggtaaggaaatg
gactccttaagattcttgtacgacggtattagaattcaagctgatcagacccctgaagat
ttggacatggaggataacgatattattgaggctcacagagaacagattggtggtgctacg
tattag

DBGET integrated database retrieval system