KEGG   Saccharomyces cerevisiae (budding yeast): YDR518WHelp
Entry
YDR518W           CDS       T00005                                 

Gene name
EUG1
Definition
protein disulfide isomerase EUG1 (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YDR518W (EUG1)
Enzymes [BR:sce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     YDR518W (EUG1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   YDR518W (EUG1)
  Exosomal proteins of colorectal cancer cells
   YDR518W (EUG1)
  Exosomal proteins of bladder cancer cells
   YDR518W (EUG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:1478608..1480161
Genome map
AA seq 517 aa AA seqDB search
MQVTTRFISAIVSFCLFASFTLAENSARATPGSDLLVLTEKKFKSFIESHPLVLVEFFAP
WCLHSQILRPHLEEAASILKEHNVPVVQIDCEANSMVCLQQTINTYPTLKIFKNGRIFDG
QVYRGVKITDEITQYMIQLYEASVIYLNSEDEIQPYLENATLPVVINRGLTGLNETYQEV
ALDLAEDYVFLSLLDSEDKSLSIHLPNTTEPILFDGNVDSLVGNSVALTQWLKVVILPYF
TDIEPDLFPKYISSNLPLAYFFYTSEEELEDYTDLFTQLGKENRGQINFIALNSTMFPHH
VRFLNMREQFPLFAIHNMINNLKYGLPQLPEEEYAKLEKPQPLDRDMIVQLVKDYREGTA
KPIVKSEEIPKEQKSNVYKIVGKTHDDIVHDDDKDVLVKYYATWCIHSKRFAPIYEEIAN
VLASDESVRDKILIAEVDSGANDILSFPVTGYPTIALYPAGNNSKPIIFNKIRNLEDVFE
FIKESGTHHIDGQAIYDKLHQAKDSEVSTEDTVHDEL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgaccacaagatttatatctgcgatagtctcgttttgcctgtttgcttctttc
acgttggctgaaaacagcgcaagagctacgccgggatcagatttactcgttctaacagag
aagaaatttaaatcattcatcgaatctcatccgttagtcctcgtcgagttttttgctcca
tggtgtttgcattctcagatcttacgccctcacttagaagaggccgcctctattttaaag
gagcataacgtcccagttgttcaaattgattgtgaggctaacagtatggtttgcctgcaa
caaactataaatacctacccaaccttgaaaatctttaaaaatggtcgtatttttgatggt
caagtctatcgcggtgtcaagatcaccgatgaaatcactcagtacatgattcagctatac
gaggcttctgtcatttatttaaattccgaagatgaaatccaaccatacttggaaaatgca
actttaccagtagtaataaacagaggcttgacaggcttgaatgaaacgtatcaagaagtc
gcactggaccttgctgaggattacgtctttttatcccttctagattcagaagataagtca
ttatcaatccacttgccaaacactacagaaccaattctgtttgatggaaatgtagactct
ttggtcggaaattccgttgctctaactcagtggttaaaagtggtaattttaccttacttt
accgacatcgaacctgatctcttccccaagtacatttctagcaatttgccgttggcttac
ttcttttatacttctgaggaagaattggaagattacactgatcttttcacgcagttaggt
aaggaaaatcgtggccaaataaatttcattgcattaaactctacaatgttcccacaccac
gttagattcctaaatatgagagaacagttcccattatttgctatccataatatgatcaat
aatctgaaatatggtttaccacaactaccagaagaagagtacgcgaaattagaaaaacca
caaccactagacagagatatgatcgttcagttggtaaaagattaccgtgaaggtactgcc
aagccaattgttaagtcagaagagattccaaaagaacaaaagtccaatgtttataaaata
gttgggaagacacatgacgacattgttcatgatgatgacaaggatgtccttgtcaaatat
tacgcgacatggtgtattcatagtaaaaggtttgcgcctatttacgaagaaattgcaaat
gtcttagcatctgatgaatctgttcgcgataaaatcttgatcgccgaagtagattcaggg
gcaaatgatatcttaagttttcctgtgacaggatatccaaccattgctttgtatcctgcc
ggaaataactctaagcctattatcttcaataaaattagaaatttggaagatgttttcgaa
tttatcaaggaatcaggtacacatcacattgacggccaggcaatttatgataaattgcac
caggccaaggattctgaagtgtctactgaagataccgtacatgatgaattataa

DBGET integrated database retrieval system