KEGG   Saccharomyces cerevisiae (budding yeast): YEL011WHelp
Entry
YEL011W           CDS       T00005                                 

Gene name
GLC3, GHA1
Definition
(RefSeq) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00500  Starch and sucrose metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YEL011W (GLC3)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     YEL011W (GLC3)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YEL011W (GLC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Glyco_hydro_66 AMPK1_CBM Aminotran_5
Motif
Other DBs
NCBI-GeneID: 856705
NCBI-ProteinID: NP_010905
SGD: S000000737
UniProt: P32775
Position
V:133120..135234
Genome map
AA seq 704 aa AA seqDB search
MYNIPDNVKGAVEFDPWLKPFADVLSERRYLADKWLYDITHATPDGSYQSLSKFARDSYK
SYGLHANPETKEITYKEWAPNAERAFLVGDFNNWDTTSHELKNKDEFGNFTITLHPLPNG
DFAIPHDSKIKVMFILPDGSKIFRLPAWITRATQPSKETSKQFGPAYEGRFWNPENPYKF
VHPRPKFSESVDSLRIYEAHVGISSPEPKITTYKEFTEKVLPRIKYLGYDAIQLMAIMEH
AYYASFGYQVTNFFAASSRFGTPEELKELIDTAHSMGILVLLDVVHSHASKNVEDGLNMF
DGSDHQYFHSISSGRGEHPLWDSRLFNYGKFEVQRFLLANLAFYVDVYQFDGFRFDGVTS
MLYVHHGVGAGGSFSGDYNEYLSRDRSFVDHEALAYLMLANDLVHEMLPNLAVTVAEDVS
GYPTLCLPRSIGGTGFDYRLAMALPDMWIKLIKEKKDDEWEMGSIVYTLTNRRYGEKVVA
YCESHDQALVGDKTLAFWLMDAAMYTDMTVLKEPSIVIDRGIALHKMIRLITHSLGGEAY
LNFEGNEFGHPEWLDFPNVNNGDSYKYARRQFNLADDPLLRYQNLNEFDRSMQLCEKRHK
WLNTKQAYVSLKHEGDKMIVFERNNLLFIFNFHPTNSYSDYRVGVEKAGTYHIVLNSDRA
EFGGHNRINESSEFFTTDLEWNNRKNFLQVYIPSRVALVLALKE
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacattccagataatgtcaaaggggctgtagaatttgatccatggttgaaaccg
tttgccgatgtactttctgaaagaagatacctagctgacaagtggttgtacgacataact
catgctacgcctgatggttcgtatcagtcactcagtaagtttgctagagattcatacaag
tcatatgggttgcatgccaatccggaaaccaaagaaatcacttacaaagagtgggcaccc
aatgcggaacgtgcatttctagtgggagatttcaataactgggataccacatctcatgag
ctcaagaacaaggacgaatttggaaattttacaatcacacttcatcctttacctaacggc
gatttcgccatccctcatgattcgaagattaaagtcatgtttattttgccagatggttcc
aagatctttcgtttacctgcgtggatcacaagggctacacagccttctaaggaaacttct
aaacagttcgggcccgcatatgaaggtaggttttggaatccagagaacccctacaaattt
gtacatccaaggccaaagtttagtgaatctgtagattccttaaggatttatgaagcccac
gtcggtatttcgagtccagaaccaaagataaccacatataaagaatttactgagaaggtc
ttacccagaatcaaatatcttggctacgatgcaattcaattaatggctattatggaacat
gcttattatgcatcatttggctaccaagtgaccaatttttttgcggcgagctcccgtttc
ggcacccctgaggaattaaaggagctgattgatactgcacattctatgggcatcctagtt
ttattggatgtagttcatagccatgcttctaaaaacgtcgaggatgggttgaacatgttt
gacggttctgatcatcagtatttccattctataagctccggtaggggtgagcatccgctg
tgggattcccgtctttttaattacggaaaatttgaagtgcagcgattcttattagcaaac
ctggcattttatgttgacgtttatcagtttgatgggtttagattcgatggtgtcacatca
atgttatacgttcatcatggtgttggtgccggtgggtcttttagcggtgactataacgaa
tatctttctcgtgacaggtccttcgtcgatcatgaagccttagcttatttaatgttagcc
aatgatttggttcacgaaatgttgccaaatctggctgtaactgttgcagaagatgtctct
ggttatccaactttatgtttaccccgctccataggtggtactggtttcgactacagatta
gcaatggctttgcctgatatgtggatcaaactaatcaaggagaagaaagatgatgaatgg
gagatgggaagtattgtatacactttaactaatagacgatatggtgaaaaagtggttgct
tattgtgagtcgcacgaccaagctttagttggtgataagacattagcgttttggttgatg
gatgccgctatgtacaccgatatgactgtattgaaggaaccatccatcgttattgaccgt
ggtattgctctacacaagatgattaggctgatcactcactcgctgggaggcgaggcttat
ttgaacttcgaaggtaatgagttcggtcatccagaatggttggatttccctaatgttaac
aatggcgatagctacaagtatgctcgtaggcagtttaatttggctgatgatcccttactg
cgttaccagaatttaaatgagtttgatagatcaatgcaattatgtgagaaaaggcataag
tggctgaacacgaaacaggcttatgtttcattaaaacatgaaggtgacaaaatgattgtg
tttgaaagaaataatctgttgtttattttcaacttccatcctacaaacagctacagcgat
tatagagttggtgtcgaaaaagctggtacttatcacatcgtgttgaactcagatcgtgct
gaatttggtggacataacagaatcaacgaaagttccgaattctttaccaccgatttggaa
tggaacaacaggaagaacttcctccaagtttatattcctagtagagtcgctttggtgctt
gccttaaaagaatga

DBGET integrated database retrieval system