KEGG   Saccharomyces cerevisiae (budding yeast): YEL032WHelp
Entry
YEL032W           CDS       T00005                                 

Gene name
MCM3
Definition
Mcm3p (EC:3.6.4.12)
Orthology
K02541  
DNA replication licensing factor MCM3 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
DNA replication
Cell cycle - yeast
Meiosis - yeast
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YEL032W (MCM3)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YEL032W (MCM3)
   04113 Meiosis - yeast
    YEL032W (MCM3)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YEL032W (MCM3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
V:86937..89852
Genome map
AA seq 971 aa AA seqDB search
MEGSTGFDGDATTFFAPDAVFGDRVRRFQEFLDTFTSYRDSVRSIQVYNSNNAANYNDDQ
DDADERDLLGDDDGDDLEKEKKAASSTSLNILPHRIIISLDDLREFDRSFWSGILVEPAY
FIPPAEKALTDLADSMDDVPHPNASAVSSRHPWKLSFKGSFGAHALSPRTLTAQHLNKLV
SVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTPAIYPTEDTEGNK
LTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKPGDRVNVVGVFKS
LGAGGMNQSNSNTLIGFKTLILGNTVYPLHARSTGVAARQMLTDFDIRNINKLSKKKDIF
DILSQSLAPSIYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLR
FVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGVVCIDEFDKMTD
VDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLL
SRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPPGYLEGEPVRERLNLSLAVGEDADINP
EEHSNSGAGVENEGEDDEDHVFEKFNPLLQAGAKLAKNKGNYNGTEIPKLVTIPFLRKYV
QYAKERVIPQLTQEAINVIVKNYTDLRNDDNTKKSPITARTLETLIRLATAHAKVRLSKT
VNKVDAKVAANLLRFALLGEDIGNDIDEEESEYEEALSKRSPQKSPKKRQRVRQPASNSG
SPIKSTPRRSTASSVNATPSSARRILRFQDDEQNAGEDDNDIMSPLPADEEAELQRRLQL
GLRVSPRRREHLHAPEEGSSGPLTEVGTPRLPNVSSAGQDDEQQQSVISFDNVEPGTIST
GRLSLISGIIARLMQTEIFEEESYPVASLFERINEELPEEEKFSAQEYLAGLKIMSDRNN
LMVADDKVWRV
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggaaggctcaacgggatttgatggagacgctactacttttttcgctccagacgctgtg
tttggtgacagagtgcgcagatttcaagagtttttagatactttcacctcatacagagac
tctgtaaggtccatacaagtttacaacagcaataacgcggccaactacaacgatgatcaa
gatgacgcagacgaacgagatttgctaggtgatgacgacggtgatgatcttgaaaaggaa
aagaaagcagcatcgtccacctcattgaatatactccctcacaggattatcatctcgctt
gatgacttgagagaattcgacaggtcgttctggtcgggcattttagtcgaaccagcatac
ttcatcccgcctgccgaaaaggcgcttactgacctagcagattccatggacgatgttcca
catcccaatgcctctgcagtatcgtctcgccatccttggaagctttcgttcaaaggctca
tttggtgcacacgcattgtctcctcgtactctaacggcacaacatttaaacaaactggtc
tctgttgagggtatcgtaactaagacttcgttggtcaggccaaagcttatcagatctgtc
cactacgcggcaaagactggtagattccattacagagattatacagatgctactacaact
ctcaccacccgcatcccaacgcctgccatctatccaacggaggacactgaaggtaacaaa
ctaaccaccgaatatgggtatagtacgttcatagaccatcagcgtatcactgtgcaagaa
atgcccgaaatggcccccgctggccaacttcccaggtccattgacgtcattctcgatgac
gaccttgtggacaagaccaagccaggtgacagagttaacgttgtcggggtattcaagtcg
cttggtgctggtggcatgaaccagtccaactctaatacattgatcgggttcaaaactctg
atcctaggtaatacggtgtatcctctccacgccagatccacgggtgtcgctgcgagacaa
atgttgacagatttcgatataagaaatatcaataaactatccaaaaaaaaggacattttc
gatatcttgtctcaatctttagcgccttctatttatggacatgaccatataaagaaagcc
attttattgatgctcatgggaggtgtggagaaaaatttagaaaatggctcgcatttaaga
ggtgacatcaatatcctaatggtgggtgatccatccactgccaagtcccaattgctaagg
tttgtgttgaatacagcatcactggcaattgctactactggtagaggttcttccggtgtc
ggtttgaccgcagcggtcactactgatagggaaacaggtgaaagaagactagaggctggt
gccatggttcttgctgaccgcggggttgtatgtattgatgaatttgataagatgacagat
gtggatagagtcgccattcatgaagtaatggaacaacaaacggtgacgattgccaaagca
ggtattcacacaacattaaatgctcgttgtagtgttattgctgccgcaaatcccgttttt
gggcagtacgatgtcaatagagatccacaccaaaacattgccctaccggactcgctgttg
tctcgttttgatttactatttgttgtgacagacgatatcaatgaaatcagagatagatcc
attagtgagcatgtcttaagaacacacagatatttgcctccaggttatttagagggtgaa
cctgtgagagagcgtttgaatttatcattagccgttggggaggatgcagatataaatcct
gaagagcattccaactccggggctggtgtagaaaatgaaggagaagatgatgaagaccat
gtcttcgaaaagttcaaccccttattacaagcaggtgctaagttagcaaaaaacaaaggt
aactataacggtacagaaattccaaagctagtcaccatcccattcttaagaaagtacgtt
caatatgccaaggaaagggttattccacagttaacacaagaagccatcaatgttattgtg
aaaaattatactgatttaagaaacgatgataataccaaaaaatcgcccattactgcaaga
actttggagactttgatcagattagccacagctcacgccaaagtcaggttatccaaaaca
gtcaacaaggtggatgctaaagtggctgccaatctactaaggtttgcactattgggtgag
gatatcggcaatgatatcgatgaagaggaaagtgaatacgaagaagctttgtcgaagagg
tctccacagaaatcaccgaaaaaaagacaaagagtcagacaaccagcaagcaactctgga
tccccaatcaaatctactccaagaaggtcaacggcatcttccgttaatgccacgccatcg
tcagcacgcagaatattacgttttcaagatgacgaacagaacgctggtgaagacgataac
gatataatgtcaccgcttcctgcggatgaggaagctgaattacaaagaaggcttcaactg
gggttgagagtgtctccaagacgtagagaacatcttcacgcacctgaggaaggttcgtcg
ggacctcttaccgaggtcggtactccaagattacctaacgtatcttctgcaggtcaggat
gatgagcaacaacagtcagttatttcttttgacaatgtggagcctggtaccatttctact
ggtagattgtctttaatctcaggtattattgcgcgtctgatgcaaacagaaatatttgaa
gaagaatcctatcctgtggcctctttgttcgaaagaatcaacgaagaactaccggaggag
gaaaaattctccgctcaagaatatttagcaggtttgaagatcatgtcggacagaaataac
ttaatggttgctgacgataaagtttggagagtctga

DBGET integrated database retrieval system