KEGG   Saccharomyces cerevisiae (budding yeast): YEL039CHelp
Entry
YEL039C           CDS       T00005                                 

Gene name
CYC7
Definition
Cyc7p
Orthology
K08738  
cytochrome c
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    YEL039C (CYC7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
V:complement(79636..79977)
Genome map
AA seq 113 aa AA seqDB search
MAKESTGFKPGSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTD
ANINKNVKWDEDSMSEYLTNPKKYIPGTKMAFAGLKKEKDRNDLITYMTKAAK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaagtacgggattcaaaccaggctctgcaaaaaagggtgctacattgttt
aaaacgaggtgtcagcagtgtcatacaatagaagagggtggtcctaacaaagttggacct
aatttacatggtatttttggtagacattcaggtcaggtaaagggttattcttacacagat
gcaaacatcaacaagaacgtcaaatgggatgaggatagtatgtccgagtacttgacgaac
ccaaagaaatatattcctggtaccaagatggcgtttgccgggttgaagaaggaaaaggac
agaaacgatttaattacttatatgacaaaggctgccaaatag

DBGET integrated database retrieval system