KEGG   Saccharomyces cerevisiae (budding yeast): YEL060CHelp
Entry
YEL060C           CDS       T00005                                 

Gene name
PRB1, CVT1
Definition
(RefSeq) proteinase B (EC:3.4.21.48)
  KO
K01336  
cerevisin [EC:3.4.21.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.48  cerevisin
     YEL060C (PRB1)
Peptidases [BR:sce01002]
 Serine Peptidases
  Family S8: subtilisin family
   YEL060C (PRB1)
Chaperones and folding catalysts [BR:sce03110]
 Intramolecular chaperones
  Subtilisin family
   YEL060C (PRB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
V:complement(40046..41953)
Genome map
AA seq 635 aa AA seqDB search
MKLENTLFTLGALGSISAALVIPNLENAADHHELINKEDHHERPRKVEFTKDDDEEPSDS
EDKEHGKFHKKGRKGQDKESPEFNGKRASGSHGSAHEGGKGMKPKHESSNDDDNDDKKKK
PHHKGGCHENKVEEKKMKGKKVKGKKHHEKTLEKGRHHNRLAPLVSTAQFNPDAISKIIP
NRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDS
FNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHRER
LNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTH
CAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKKGFKGS
TANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTLSD
DRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSD
SEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWNDTKKSH
SSGFKQELNMDEFIGSKTDLIFDQVRDILDKLNII
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagaaaatactctatttacactcggtgccctagggagcatctctgctgctttg
gtcatcccaaatcttgaaaatgccgccgaccaccacgaactgattaacaaggaagatcac
cacgagagacccagaaaagtggaattcactaaggacgatgatgaggagccatctgactct
gaagataaagaacatggaaagttccataagaagggccgcaagggccaagacaaggagtct
ccggaattcaacggtaaacgtgcaagtggctctcatgggagcgcccacgagggaggaaag
ggcatgaagcctaagcatgaaagttccaatgatgatgataatgatgataagaagaagaag
cctcaccataagggtggctgccacgaaaataaggtggaggagaagaagatgaaaggtaag
aaagtcaagggcaagaagcaccacgaaaagacgttggagaaagggaggcaccacaacagg
ctggctcctctcgtgtccactgcacaattcaacccagacgcgatctccaagatcatcccc
aaccgctacattatagtcttcaagagaggtgcccctcaagaagagatcgatttccacaag
gaaaacgtccagcaggcacaacttcaatccgtagagaacttatctgccgaagacgctttc
ttcatttctactaaagacacctccttgtccacctctgaggctggcggtatccaggactca
ttcaacatcgataatcttttctccggttacatcggttacttcacccaagagattgtcgac
ttgatacgtcaaaacccattagtagactttgttgagagagactctattgtcgaggctaca
gaatttgacactcaaaatagcgccccatgggggttggcccgtatttcccacagagagcgc
ctcaacctggggtccttcaacaagtatctctacgatgatgatgccggtcgcggtgtcacg
tcctatgttattgacacgggtgtcaacatcaaccacaaggacttcgaaaagagagccatt
tgggggaaaaccatcccacttaacgacgaagatctcgacggtaacggccacggtacccac
tgtgccggtactatcgcttccaaacactacggtgtcgctaaaaatgccaacgttgttgcg
gtgaaagtcttgagatcaaacgggtctggtaccatgtctgatgtcgtcaaaggtgtcgaa
tatgccgcaaaggcgcaccaaaaagaagcccaagaaaagaaaaaggggttcaaaggttcc
acagccaatatgtcgcttggtggtggcaagtccccagctttggacttggctgttaatgca
gccgttgaagtcggtattcactttgccgtggctgctggtaacgaaaaccaagacgcttgt
aatacctccccagcttctgctgacaaggccatcaccgtcggagcttccacgttgagcgat
gacagagcctacttttccaactggggtaagtgtgtcgacgttttcgccccaggtttaaac
attttgtccacctacattggaagtgatgacgccaccgccactttatcgggtacctcaatg
gcttcccctcacgttgctggtttgttgacctactttttgtctttgcaaccaggttctgat
agtgaatttttcgaattgggccaggattctttgactcctcagcaattgaaaaagaagcta
attcattacagtacaaaggacattttgttcgatatccctgaagacactccaaatgtttta
atctacaacggtggtggtcaagatttgtccgctttctggaatgataccaaaaagtcccat
tcatctggtttcaagcaagaattgaacatggatgaattcattggatcaaagaccgattta
atctttgatcaagtgagagatattcttgataaattgaatattatttaa

DBGET integrated database retrieval system