KEGG   Saccharomyces cerevisiae (budding yeast): YER014WHelp
Entry
YER014W           CDS       T00005                                 

Gene name
HEM14
Definition
(RefSeq) oxygen-dependent protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00860  Porphyrin and chlorophyll metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YER014W (HEM14)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     YER014W (HEM14)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     YER014W (HEM14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_8 Amino_oxidase DAO Thi4 NAD_binding_9 Pyr_redox Pyr_redox_2 Mqo
Motif
Other DBs
NCBI-GeneID: 856733
NCBI-ProteinID: NP_010930
SGD: S000000816
UniProt: P40012
Position
V:182600..184219
Genome map
AA seq 539 aa AA seqDB search
MLLPLTKLKPRAKVAVVGGGVSGLCFTYFLSKLRPDVEITLFESQNRTGGWIYSCNTRDM
SGNPIMLEKGPRTLRGVSDGTVLIMDTLKDLGKEAVIQSIDKGCIADKKFLLDPSDKLVQ
VPNSISTTVKFLLNPLGKGLITGMMGEWFRKKSPHPGQDESVESICDRRFGNNYISNNMI
SALLRGIYGDDVSLLSAKRTFKKIYYNELKHGSNTQAMIDNMRGKSRSKKTENLHQSLTG
CLNDYSNAFGKDRSKLLDLSNTLKKYPMLGLAGGLETFPKIVRNALNEFKNVKIVTGNPV
TQIMKRPANETTIGLKAKSGDQYETFDHLRLTITPPKIAKLLPKDQNSLSKLLDEIQSNT
IILVNYYLPNKDVIDADLQGFGYLVPKSNKNPGKLLGVIFDSVIERNFKPLFDKLSTNPN
ALNKYTKVTAMIGGCMLNEHGVPVVPSREVTINAVKDALNNHLGISNKDLEAGQWEFTIA
DRCLPRFHVGYDAWQERAERKLQESYGQTVSVGGMGFSRSPGVPDVIVDGFNDALQLSK
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgttattaccattaacaaagctaaaaccgagagcaaaagttgctgttgtagggggtggc
gtttctggactatgttttacttattttttaagcaagttgagaccggatgttgaaatcaca
ctgttcgaatcgcagaacagaactgggggttggatatattcttgtaacacaagagatatg
agtgggaacccaattatgttggagaagggacccagaacattgaggggcgtatcagacggg
accgttctgattatggatacccttaaagacttgggcaaggaagcagttattcaaagcatt
gataaaggttgcattgcagacaaaaagtttctactagaccccagtgataaactcgtgcag
gttcctaattcgatatctacaacagtaaaatttctgctgaatccgttgggaaaaggactc
atcacgggtatgatgggagaatggttcagaaaaaaatctccacatcctggccaagacgaa
agtgtcgaatccatttgtgacagaaggtttgggaataactacatatcaaacaatatgatc
agtgccttactaagaggtatctatggggatgacgtttccctattaagtgccaagagaacg
tttaagaaaatatactacaatgaactaaagcacggatctaacacacaagctatgattgat
aatatgcgcggaaagtcaagaagtaaaaaaactgagaacctgcaccaatctttaactggc
tgccttaacgactactcaaatgcgtttggaaaagacaggtcaaagttattagacttatcc
aacacgctaaagaaatatcccatgttgggtcttgctgggggactagaaacgtttcccaag
atagtcagaaatgctttgaacgaatttaaaaacgtcaaaatagttactgggaacccggtt
acgcaaataatgaaacgccctgctaacgaaacgacaatcggattgaaagcgaaatctggc
gaccaatacgaaacatttgaccatttaagacttacgataacacctcccaaaatcgctaaa
ttgctaccgaaggatcaaaattcattatccaagttattagatgagatacaatcaaacaca
ataattttagttaattattatttgccaaacaaagatgtaatagatgccgatctacaaggc
tttggatacttggttcccaaatccaataagaatccagggaaattgcttggtgtaattttc
gattctgttatcgaaaggaatttcaaaccactttttgacaaactctccacaaacccaaac
gccctcaacaaatatacaaaagtgactgcgatgataggaggttgtatgctcaatgaacac
ggtgttcctgtagtgccatccagggaggtaaccattaatgcagtcaaagatgcgctgaac
aaccacctcggcatcagtaacaaggatctggaagctggtcagtgggaattcactatcgcc
gatagatgtctgccaagatttcatgtaggttatgacgcatggcaagaaagagctgaaagg
aagttgcaagaatcttacggccaaacagtttctgtggggggaatgggattttctagaagt
cccggtgtccctgacgttattgtagacggctttaacgacgccttacagctaagcaaataa

DBGET integrated database retrieval system