KEGG   Saccharomyces cerevisiae (budding yeast): YER014WHelp
Entry
YER014W           CDS       T00005                                 

Gene name
HEM14
Definition
oxygen-dependent protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YER014W (HEM14)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     YER014W (HEM14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
V:182600..184219
Genome map
AA seq 539 aa AA seqDB search
MLLPLTKLKPRAKVAVVGGGVSGLCFTYFLSKLRPDVEITLFESQNRTGGWIYSCNTRDM
SGNPIMLEKGPRTLRGVSDGTVLIMDTLKDLGKEAVIQSIDKGCIADKKFLLDPSDKLVQ
VPNSISTTVKFLLNPLGKGLITGMMGEWFRKKSPHPGQDESVESICDRRFGNNYISNNMI
SALLRGIYGDDVSLLSAKRTFKKIYYNELKHGSNTQAMIDNMRGKSRSKKTENLHQSLTG
CLNDYSNAFGKDRSKLLDLSNTLKKYPMLGLAGGLETFPKIVRNALNEFKNVKIVTGNPV
TQIMKRPANETTIGLKAKSGDQYETFDHLRLTITPPKIAKLLPKDQNSLSKLLDEIQSNT
IILVNYYLPNKDVIDADLQGFGYLVPKSNKNPGKLLGVIFDSVIERNFKPLFDKLSTNPN
ALNKYTKVTAMIGGCMLNEHGVPVVPSREVTINAVKDALNNHLGISNKDLEAGQWEFTIA
DRCLPRFHVGYDAWQERAERKLQESYGQTVSVGGMGFSRSPGVPDVIVDGFNDALQLSK
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgttattaccattaacaaagctaaaaccgagagcaaaagttgctgttgtagggggtggc
gtttctggactatgttttacttattttttaagcaagttgagaccggatgttgaaatcaca
ctgttcgaatcgcagaacagaactgggggttggatatattcttgtaacacaagagatatg
agtgggaacccaattatgttggagaagggacccagaacattgaggggcgtatcagacggg
accgttctgattatggatacccttaaagacttgggcaaggaagcagttattcaaagcatt
gataaaggttgcattgcagacaaaaagtttctactagaccccagtgataaactcgtgcag
gttcctaattcgatatctacaacagtaaaatttctgctgaatccgttgggaaaaggactc
atcacgggtatgatgggagaatggttcagaaaaaaatctccacatcctggccaagacgaa
agtgtcgaatccatttgtgacagaaggtttgggaataactacatatcaaacaatatgatc
agtgccttactaagaggtatctatggggatgacgtttccctattaagtgccaagagaacg
tttaagaaaatatactacaatgaactaaagcacggatctaacacacaagctatgattgat
aatatgcgcggaaagtcaagaagtaaaaaaactgagaacctgcaccaatctttaactggc
tgccttaacgactactcaaatgcgtttggaaaagacaggtcaaagttattagacttatcc
aacacgctaaagaaatatcccatgttgggtcttgctgggggactagaaacgtttcccaag
atagtcagaaatgctttgaacgaatttaaaaacgtcaaaatagttactgggaacccggtt
acgcaaataatgaaacgccctgctaacgaaacgacaatcggattgaaagcgaaatctggc
gaccaatacgaaacatttgaccatttaagacttacgataacacctcccaaaatcgctaaa
ttgctaccgaaggatcaaaattcattatccaagttattagatgagatacaatcaaacaca
ataattttagttaattattatttgccaaacaaagatgtaatagatgccgatctacaaggc
tttggatacttggttcccaaatccaataagaatccagggaaattgcttggtgtaattttc
gattctgttatcgaaaggaatttcaaaccactttttgacaaactctccacaaacccaaac
gccctcaacaaatatacaaaagtgactgcgatgataggaggttgtatgctcaatgaacac
ggtgttcctgtagtgccatccagggaggtaaccattaatgcagtcaaagatgcgctgaac
aaccacctcggcatcagtaacaaggatctggaagctggtcagtgggaattcactatcgcc
gatagatgtctgccaagatttcatgtaggttatgacgcatggcaagaaagagctgaaagg
aagttgcaagaatcttacggccaaacagtttctgtggggggaatgggattttctagaagt
cccggtgtccctgacgttattgtagacggctttaacgacgccttacagctaagcaaataa

DBGET integrated database retrieval system