KEGG   Saccharomyces cerevisiae (budding yeast): YER060WHelp
Entry
YER060W           CDS       T00005                                 

Gene name
FCY21
Definition
(RefSeq) purine-cytosine permease
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Position
V:274567..276153
Genome map
AA seq 528 aa AA seqDB search
MPQTHEMSLNGTQYLKYELKDLESRAHDAKTPSTNEFYDDVESHGTEELVEAKLSFLNRI
AAGLSAETKGIEPITEDEKTDDSILNAASMWFSANMVLPAYAIGALGPMVFDLNFGQSVF
VIIFFNLLGLVSVAFFSVFGAELGLRQMILSRYLVGNIAARIFSFINFIACIGWGIVNTV
ASSQVLNMVNPGHQCPLWAGCIVIIGATVIVTFFGYGVIHAYEKWAWVPNFAVFLVIIAR
LARSKKFVLGEWTSGPTTAGNVLSFGSTVYGFAAGWTTYAADYTVYMPRKTNKYKIFFSL
VVGLATPLYFTMILGAAVAMAAIGDPAWKTYYDENSIGGLTFAVLVPNSVHGFGQFCCVL
LSLSTIANNVPNMYTIALSVQATWEPLAKVPRVIWTLLGNAAALGIAIPACYYFSTFMNY
FMDSIGYYLAIYIAIACSEHFIYRRSFSAYNVDDWDSWERLPIGIAGTAALIVGAFGVAL
GMCQTYWVGEISRLIGDYGGDIGFELGLSWAFIVYNIARPFELKYFGR
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaaacgcacgaaatgtccctgaacggcactcaatacttaaaatatgaacttaaa
gaccttgagtctcgagctcacgatgcaaagactccttcaacaaatgaattctatgatgat
gtagaatcgcacggaacagaagaattagttgaagctaaactgtcgtttttgaacagaatt
gctgctggtttaagtgccgagacaaagggtattgaaccgattacagaagatgaaaaaact
gatgattctatactgaacgctgcatctatgtggttttcagcaaatatggttctgcctgct
tatgccattggcgccctagggcctatggtgtttgatctaaatttcggccaaagcgttttc
gttattattttctttaacctcttaggcttggtatcagttgctttcttttctgttttcggt
gcagagctgggcctaagacagatgattttgtctagatatttagttggcaatatcgcagcc
aggatcttctctttcatcaattttattgcctgtatcggttggggtatcgttaataccgta
gcaagctcgcaagtcctgaatatggttaaccccggtcatcaatgtcctctctgggctggt
tgtatagttattatcggtgctactgtaattgtaacttttttcggctatggagtcattcat
gcttacgagaaatgggcgtgggtaccaaattttgccgtttttttggtaataattgctcgt
ttggcaaggtctaaaaaatttgtccttggggagtggacatctggtcctactacagcaggt
aacgtgctttcatttggatcaacagtttatgggtttgctgcaggctggacaacatatgcg
gctgactataccgtttatatgccaaggaaaacgaacaagtataaaatttttttctcgctt
gtagttgggttagcaacaccattatattttactatgatacttggtgcagctgtagcaatg
gcagctatcggcgatccagcctggaagacgtattatgacgaaaattccataggtggttta
acttttgccgttcttgtccctaattctgttcacggattcggtcagttctgttgcgtgtta
ttgtctctgtccactatcgctaataatgttcccaacatgtatactattgctttatcggtg
caagccacgtgggaacctcttgcgaaagtcccaagagttatttggactttattaggcaat
gcggccgcactgggtattgccattcctgcctgctactatttttctaccttcatgaattac
ttcatggattccataggttattatttggctatttatattgccattgcatgttcagagcat
tttatttataggcgttccttcagtgcttacaatgttgatgattgggatagttgggaacgt
ctacctatcggcattgcaggtactgctgccttaattgttggtgcctttggcgtagcgttg
ggtatgtgccaaacttattgggttggcgagatcagccgtttgatcggagactacggtggt
gatattggattcgagttaggactaagttgggcatttatagtttacaacattgctagaccc
tttgagctcaagtactttggtcgttaa

DBGET integrated database retrieval system