KEGG   Saccharomyces cerevisiae (budding yeast): YER065CHelp
Entry
YER065C           CDS       T00005                                 

Gene name
ICL1
Definition
(RefSeq) isocitrate lyase 1
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00630  Glyoxylate and dicarboxylate metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01200  Carbon metabolism
Module
sce_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YER065C (ICL1)
Enzymes [BR:sce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YER065C (ICL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 856794
NCBI-ProteinID: NP_010987
SGD: S000000867
UniProt: P28240
Position
V:complement(285241..286914)
Genome map
AA seq 557 aa AA seqDB search
MPIPVGNTKNDFAALQAKLDADAAEIEKWWSDSRWSKTKRNYSARDIAVRRGTFPPIEYP
SSVMARKLFKVLEKHHNEGTVSKTFGALDPVQISQMAKYLDTIYISGWQCSSTASTSNEP
GPDLADYPMDTVPNKVEHLFKAQLFHDRKQLEARSKAKSQEELDEMGAPIDYLTPIVADA
DAGHGGLTAVFKLTKMFIERGAAGIHMEDQTSTNKKCGHMAGRCVIPVQEHVNRLVTIRM
CADIMHSDLIVVARTDSEAATLISSTIDTRDHYFIVGATNPNIEPFAEVLNDAIMSGASG
QELADIEQKWCRDAGLKLFHEAVIDEIERSALSNKQELIKKFTSKVGPLTETSHREAKKL
AKEILGHEIFFDWELPRVREGLYRYRGGTQCSIMRARAFAPYADLVWMESNYPDFQQAKE
FAEGVKEKFPDQWLAYNLSPSFNWPKAMSVDEQHTFIQRLGDLGYIWQFITLAGLHTNAL
AVHNFSRDFAKDGMKAYAQNVQQREMDDGVDVLKHQKWSGAEYIDGLLKLAQGGVSATAA
MGTGVTEDQFKENGVKK
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcctatccccgttggaaatacgaagaacgattttgcagctttacaagcaaaactagat
gcagatgctgccgaaattgagaaatggtggtctgactcacgttggagtaagactaagaga
aattattcagccagagatattgctgttagacgcgggacattcccaccaatcgaataccca
tcttcggtcatggccagaaaattattcaaggtattagagaagcatcacaatgagggtaca
gtctctaaaactttcggtgccctagatcctgtccagatttctcaaatggcaaaatactta
gacacaatctatatttctggttggcagtgttcatcaactgcttccacctcaaatgaacct
ggtccagacttagctgattatccaatggacaccgttccaaacaaagtggaacatttgttc
aaggcccaattgtttcacgacagaaaacaactagaggcacggtcaaaggctaaatctcag
gaagaactcgatgagatgggtgccccaattgactacctaacaccaattgtcgctgatgca
gacgcaggccacggcggtttaaccgcagtcttcaaattgaccaagatgttcattgagcgt
ggtgctgctgggatccacatggaagaccagacatctacaaataagaaatgtgggcatatg
gcaggaagatgtgttatacccgttcaggaacatgttaacagattggtgactattagaatg
tgtgctgatatcatgcattctgacttaattgtcgttgctaggactgattcagaagcagcc
actttgattagctcaaccatcgataccagagatcattatttcattgtcggtgccaccaat
ccaaatatcgagccatttgccgaagttttaaatgatgccatcatgagtggtgcatcagga
caagaactagctgacattgaacaaaaatggtgtagagacgctggactcaagttattccat
gaagccgtcattgatgaaattgaaagatcagccctgtcaaataagcaagaattgattaag
aaattcacctctaaagtgggtccattgactgaaacatcccacagagaagccaagaagctc
gctaaagaaattcttggccacgaaattttcttcgactgggagctaccacgcgtaagggaa
gggttgtaccgttacagaggtgggacgcaatgttctatcatgagggcccgtgcatttgct
ccatatgctgatttggtatggatggaatctaactacccagacttccaacaggccaaggag
tttgcagaaggtgttaaagagaaattccctgaccaatggctagcttacaacttgtctcca
tcctttaactggccaaaagccatgtccgttgatgaacaacacaccttcatccaaaggctg
ggtgatctaggttacatctggcaatttatcacattggccggtttacacactaacgcttta
gctgtccataacttctctcgtgactttgccaaggatgggatgaaagcttatgcccagaat
gttcagcagagggaaatggacgatggtgttgatgtgttgaaacatcaaaaatggtctggt
gcggagtacatcgatgggttattgaagttagctcaaggtggtgttagcgcaacagctgct
atgggaaccggtgtcacagaagatcaattcaaagaaaatggcgtaaagaaatag

DBGET integrated database retrieval system