KEGG   Saccharomyces cerevisiae (budding yeast): YER089CHelp
Entry
YER089C           CDS       T00005                                 

Gene name
PTC2
Definition
Ptc2p (EC:3.1.3.16)
Orthology
K14803  
protein phosphatase 2C homolog 2/3 [EC:3.1.3.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     YER089C (PTC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
V:complement(335946..337340)
Genome map
AA seq 464 aa AA seqDB search
MGQILSNPVIDKESHSGADSLTAFGLCAMQGWRMSMEDSHILEPNVLTKSDKDHIAFYGI
FDGHGGAKVAEYCGNKIVEILQEQKSFHEGNLPRALIDTFINTDVKLLQDPVMKEDHSGC
TATSILVSKSQNLLVCGNAGDSRTVLATDGNAKALSYDHKPTLASEKSRIVAADGFVEMD
RVNGNLALSRAIGDFEFKSNPKLGPEEQIVTCVPDILEHSLDYDRDEFVILACDGIWDCL
TSQDCVDLVHLGLREGKTLNEISSRIIDVCCAPTTEGTGIGCDNMSIVVVALLKEGEDVA
QWSDRMKSKAHRTSVRSFADKRRRVFSYYDFSKCNDEQVFAITTKKPQDKFTRDHEAAVA
SVTAADNDDPMDIDDTDADTDAENLDPSSQSKSKTSGPIDLASLEALLGATGGVKTDSNG
NKVTYTLPQSALAQLLQTMGHDPASSHPENDSNTDHKAGRSHLQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaattctatcaaacccggtaattgataaagagagccactccggtgctgactcc
ttgaccgcgtttggactgtgtgcaatgcaagggtggcggatgtcaatggaggattcacac
attctagagcctaatgttttgacaaagtccgataaggaccatattgcattttacggtata
ttcgatggtcatggtggcgctaaagtagcagaatactgtggtaataaaatagtggagatc
ctgcaagagcagaaatcgttccatgaaggaaatttaccaagggctttgattgatactttc
ataaacacagacgtgaaactgttacaagatcctgtgatgaaagaagaccatagcggatgt
acggctacatccatattagtatcaaagtcccagaacttgttagtatgtggtaacgctggt
gacagtagaaccgtactcgccaccgacgggaacgcaaaggcattatcatacgatcacaag
cccactctagcaagcgaaaaatcacgtattgtggcagctgatggcttcgtagaaatggat
agggtcaacggtaacttggcgctctctcgtgccattggtgattttgagttcaaatccaac
cccaaattgggccccgaggagcaaatagtgacatgtgttccggacattctcgagcattct
ctagattacgatagggacgagtttgtaatcttagcctgtgatggtatctgggattgtttg
acttcccaagattgtgtggacttggttcatctcggccttcgcgaaggcaagacattgaat
gaaatttcttcgcggatcatcgatgtctgttgtgctcccaccacagaggggacgggtatt
ggatgcgacaacatgagtatagtggttgtcgcgctgctgaaagaaggtgaagacgtcgct
caatggagcgaccgtatgaagtccaaggcccaccgcacatcagtgcgttcttttgcagac
aagagaagaagggtgtttagttactacgatttttccaaatgtaacgacgaacaggtgttc
gctatcactacgaagaaacctcaggacaaattcactcgcgaccacgaagccgctgtggcc
tcggtgactgccgccgataacgacgatccaatggacatagacgacacggacgctgacaca
gatgcagaaaatcttgacccttccagccaatccaagagcaagacctccggccccattgat
ctagcatccttggaggcgctacttggtgctacaggaggagtgaagacagacagcaacggg
aacaaagtcacctacactcttccccagtctgccttggcccaactgctccaaaccatgggc
catgacccggcttcctcccatcccgagaatgacagtaacactgaccacaaggccggccgt
tcccacttgcaatga

DBGET integrated database retrieval system