KEGG   Saccharomyces cerevisiae (budding yeast): YER107CHelp
Entry
YER107C           CDS       T00005                                 

Gene name
GLE2, RAE1
Definition
Gle2p
Orthology
K14298  
mRNA export factor
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:sce03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
V:complement(373448..374545)
Genome map
AA seq 365 aa AA seqDB search
MSFFNRSNTTSALGTSTAMANEKDLANDIVINSPAEDSISDIAFSPQQDFMFSASSWDGK
VRIWDVQNGVPQGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMH
SAPIKVLRFVQCGPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPERVYSMDNKQSLLV
VATAERHIAIINLANPTTIFKATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDG
MQKKSGFSFKCHRQTNPNRAPGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQ
RHRLKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDYPNVIRLHATTDEEVK
EKKKR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttttaatcgatcaaatacaacctcagctttgggaacgagtactgcaatggcg
aatgaaaaggatttggccaatgatattgtcattaatagcccagcagaggactcaatatcg
gatattgcgttttcaccgcaacaagatttcatgtttagtgccagttcctgggacggtaag
gtacgtatttgggatgtccaaaatggtgtacctcaaggtagagcgcagcatgaaagctcc
agccctgtattatgtaccagatggtcgaatgatggtacaaaagtagcctcaggcgggtgt
gataatgccctgaaattgtacgatattgccagtggtcaaacacagcaaattggaatgcat
tctgcgccaataaaagtattacgttttgtacaatgtggaccatcgaacacagagtgtata
gtaaccggatcctgggataaaaccataaaatattgggatatgagacaaccccagcccgta
tccaccgtaatgatgcctgaaagagtatattcgatggataataaacagtctctgttagta
gtggctactgccgaaagacatatcgctattatcaatctagcaaacccaacaacgattttt
aaggcaaccacgtcacctttaaaatggcaaactcgatgcgtggcatgttataatgaagcc
gatggatatgcgattggttcagtggaaggtagatgctccataaggtatatcgatgatggt
atgcagaaaaaatcaggcttttcatttaaatgccatcgtcaaaccaatcctaatagggca
cctggctccaatggtcaatctctagtgtatcctgtaaatagcattgcatttcatccatta
tatggtacttttgttacggctggtggtgatggtaccttcaatttttgggataagaatcaa
aggcatagattgaaaggctatcctactttgcaagcatctattcctgtatgcagcttcaat
aggaatggtagcgtatttgcgtacgctctaagttatgattggcatcaaggccatatgggc
aacagacccgactatccaaacgtcattaggctacatgccacaactgatgaagaggttaaa
gagaaaaagaaaaggtga

DBGET integrated database retrieval system