KEGG   Saccharomyces cerevisiae (budding yeast): YER107CHelp
Entry
YER107C           CDS       T00005                                 

Gene name
GLE2, RAE1
Definition
RNA export factor GLE2
Orthology
K14298  
mRNA export factor
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YER107C (GLE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
V:complement(373448..374545)
Genome map
AA seq 365 aa AA seqDB search
MSFFNRSNTTSALGTSTAMANEKDLANDIVINSPAEDSISDIAFSPQQDFMFSASSWDGK
VRIWDVQNGVPQGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMH
SAPIKVLRFVQCGPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPERVYSMDNKQSLLV
VATAERHIAIINLANPTTIFKATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDG
MQKKSGFSFKCHRQTNPNRAPGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQ
RHRLKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDYPNVIRLHATTDEEVK
EKKKR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttttaatcgatcaaatacaacctcagctttgggaacgagtactgcaatggcg
aatgaaaaggatttggccaatgatattgtcattaatagcccagcagaggactcaatatcg
gatattgcgttttcaccgcaacaagatttcatgtttagtgccagttcctgggacggtaag
gtacgtatttgggatgtccaaaatggtgtacctcaaggtagagcgcagcatgaaagctcc
agccctgtattatgtaccagatggtcgaatgatggtacaaaagtagcctcaggcgggtgt
gataatgccctgaaattgtacgatattgccagtggtcaaacacagcaaattggaatgcat
tctgcgccaataaaagtattacgttttgtacaatgtggaccatcgaacacagagtgtata
gtaaccggatcctgggataaaaccataaaatattgggatatgagacaaccccagcccgta
tccaccgtaatgatgcctgaaagagtatattcgatggataataaacagtctctgttagta
gtggctactgccgaaagacatatcgctattatcaatctagcaaacccaacaacgattttt
aaggcaaccacgtcacctttaaaatggcaaactcgatgcgtggcatgttataatgaagcc
gatggatatgcgattggttcagtggaaggtagatgctccataaggtatatcgatgatggt
atgcagaaaaaatcaggcttttcatttaaatgccatcgtcaaaccaatcctaatagggca
cctggctccaatggtcaatctctagtgtatcctgtaaatagcattgcatttcatccatta
tatggtacttttgttacggctggtggtgatggtaccttcaatttttgggataagaatcaa
aggcatagattgaaaggctatcctactttgcaagcatctattcctgtatgcagcttcaat
aggaatggtagcgtatttgcgtacgctctaagttatgattggcatcaaggccatatgggc
aacagacccgactatccaaacgtcattaggctacatgccacaactgatgaagaggttaaa
gagaaaaagaaaaggtga

DBGET integrated database retrieval system