KEGG   Saccharomyces cerevisiae (budding yeast): YER133WHelp
Entry
YER133W           CDS       T00005                                 

Gene name
GLC7, CID1, DIS2
Definition
Glc7p (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    YER133W (GLC7)
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    YER133W (GLC7)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     YER133W (GLC7)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     YER133W (GLC7)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     YER133W (GLC7)
Spliceosome [BR:sce03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    YER133W (GLC7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
V:join(432495..432671,433197..433958)
Genome map
AA seq 312 aa AA seqDB search
MDSQPVDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLN
SMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDM
ELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQK
SLPRQAGGRKKK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggactcacaaccagttgacgttgataatatcatcgatagattattggaagtaagagga
tctaaacctggtcaacaagttgatctagaagaaaatgaaatcagatacttatgttcgaaa
gccagatctatattcataaagcaacccattttactagagttagaagccccaattaaaata
tgtggtgacattcatgggcaatactatgatttactacgtctatttgagtacggtggattc
ccgccagaatctaattatctatttttgggtgattatgtcgaccgtggtaaacaatcctta
gagactatttgtctattactggcttacaaaattaagtatccagaaaactttttcatttta
agagggaaccatgaatgtgcttccattaatagaatttacgggttttatgatgaatgtaag
agacgttataatatcaaactttggaaaactttcacggattgtttcaattgtttaccaatt
gctgcaattattgatgagaaaatcttctgtatgcatggtggtctctcaccagatttgaat
agtatggaacagatcagaagggtgatgaggccaacagatattcccgacgttggcttatta
tgtgacttattgtggtcagatccagataaagatatcgtaggttggagtgaaaatgataga
ggtgtttctttcacttttggtcctgatgtagtgaacagatttttacagaaacaagatatg
gagttgatttgcagggcccatcaagttgtggaagatggttatgaattctttagtaaaaga
caattggtgacacttttcagtgctccgaattattgtggtgaatttgataacgctggtgca
atgatgagtgttgatgaaagtttattatgttcttttcaaattttaaagccagcccaaaaa
agtctaccaaggcaagctgggggtagaaagaaaaaataa

DBGET integrated database retrieval system