KEGG   Saccharomyces cerevisiae (budding yeast): YER140WHelp
Entry
YER140W           CDS       T00005                                 

Gene name
EMP65
Definition
Emp65p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
V:451565..453235
Genome map
AA seq 556 aa AA seqDB search
MQHKDTAVAKDTAKKRLLRRNSAPSAIHIISRLDKKWSFLWNTIDRHNIVEEQDESSAAK
SEEEHEDDYELEQLLNMIRIPMFLEKFMLFALLTSLDCFLYYFTVLPIRLIKGYVKQFKS
YRQHYRLQQRSGHKNKIPFRYRITSREYKERCMIFIIVISSILLSKLDTSKLYHRIKRQS
TMKLYMLFSVLEMADKMLASLGQSLLTVMLSRKNSERILLHKCLLVSMSLTYVTIHGYVL
VYQAISLNIAVNSYSNALLTLLLSMQFAEIKSSVLKKFDKEGFFQITIADVVERFKLTLL
LSITGLRNLQSWSSSLSNTSINFWSPRSTLSIVINILCGPMVSVVGSEVLVDWAKHAYIT
KFNRIRPQIYDKFYYIIYKDYSTRTHKLEDRLGLPLPAFVVLFIVMVRPTLFKSSEPSYL
PSLFRILFMGASVFLLALLAKFTLDLILIKWSKRIEQRFRDQAFNTVVTEEEYVPGLLSG
GMGKVDVSTRIALHSDYNKENRIETESVSPMRKRKTTLTAECTPPSLNDIRRQKDSKNPR
SLENVARYKMVSKRIW
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacaaggatacggcagtagcgaaggacacagctaaaaaacgtttactgagaaga
aatagtgcgccgtcagctatacatataatttcacgattagacaaaaagtggtccttccta
tggaatactatagatagacacaatattgttgaagagcaagatgaaagtagcgctgcaaaa
agcgaagaagaacatgaggatgattatgaattggaacaattactcaacatgataagaata
ccaatgttcctggaaaagttcatgctctttgcacttttaacaagcttggactgttttttg
tattactttactgtattaccgatacgactgataaagggatatgtaaagcaattcaagagt
tatcgtcagcattatcgcctgcaacaacggtctgggcataagaataaaataccctttcga
tatagaataacttcaagagaatataaagagagatgtatgatttttatcatcgtgatttca
tccattttgttgagcaaactagacacctcaaaactatatcacaggataaaacggcaaagt
acgatgaaattgtacatgctattcagtgtactggaaatggcggacaaaatgttggcaagt
ttgggccagagcttattaacggttatgctttctaggaaaaactcggaacggatattactg
cataaatgtttgttagtgtcaatgagcttgacatatgtgactatacacggctatgtattg
gtttaccaggccatttcattaaacatagccgtgaattcgtattccaatgccttgctaact
ttattactatccatgcaatttgcagaaatcaaatcatcggttttaaagaaatttgataag
gagggatttttccaaataaccattgcagacgtagtggaaagatttaagttgaccttatta
ttgtcaataactggccttaggaacctccagtcgtggtcatcttcattatcgaacacaagc
atcaatttctggagtccacgttccacattatcaatcgtcattaacatactttgtgggccg
atggtaagcgtggtagggagtgaagtgttagtggattgggcaaagcatgcttacatcaca
aaattcaatcggatccgcccacagatatatgataagttctattatataatatacaaggat
tattctacgagaacgcacaaattagaagatagattgggattgcctttacctgcattcgtt
gtcctttttattgtaatggtgaggccaacactttttaaatcatcggaaccttcttacctt
ccttcgctatttaggatcctcttcatgggggcatccgtgtttttactagcattgttggca
aaatttacactagatcttattttaatcaaatggagcaaacggatagagcaacggttcaga
gaccaagctttcaataccgttgtaactgaagaagaatacgtcccaggtttactctcgggc
ggtatgggtaaagtcgacgtgtctacaagaattgcattacattctgattacaataaagag
aatcgtatagagaccgaaagtgtatcgccaatgcggaaaagaaaaactactttaactgct
gaatgtactcctcctagcctaaatgatattagaagacagaaagattccaagaatccacga
tcgcttgaaaatgtcgctcgctataaaatggtttctaaaagaatatggtaa

DBGET integrated database retrieval system