KEGG   Saccharomyces cerevisiae (budding yeast): YER144CHelp
Entry
YER144C           CDS       T00005                                 

Gene name
UBP5
Definition
(RefSeq) Ubp5p (EC:3.4.19.12)
  KO
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    YER144C (UBP5)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     YER144C (UBP5)
Peptidases [BR:sce01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YER144C (UBP5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
V:complement(457806..460223)
Genome map
AA seq 805 aa AA seqDB search
MGSEQALSEVVESAKERFGRLRHLVQKFLDDDDVPQECLPLLQECAEIWSSYVDACQDIT
MQAPKEDANRLSKGFLRLNETAFLYYMIVYTLLEDTLPRLKEFSSNKDQNVRNLYGERIQ
LLHNDPNIERIRNVIENYPKFIQLQTIEPGKLSSMLHFHGDALLLIDVRPRSEFVRAHIK
CKNIICIDPASFKDSFTDQQIESVSLITSPHSDITFFSNRDKFKFIILYTDTQLHNNFQQ
RQTRILAKILSQNSVIKPLSGTKILILENGFSNWVKLGGAYQSSVSETAHLTSSSSTPAF
GSPQVPTGLFNQKSLSPNKDKSMPMVSMNTQPLLTTVQRPQLPLYYSDLPIIPQPSPNRN
SPTVQKFSPHPPTTLSKLNTPSTIQNKANTVERISPDIRAAQAHAYLPPASNVFSPRIPP
LPQQNLSSSRQTILNNSQVLDLDLIVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYL
NFINFDSSRGSKGLLAKNFAILVNNMHRHGAFTPPNVRTIPVQTIQFKKICGHINPMYSD
SMQQDCQEFCQFLLDGLHEDLNQNGSKKHLKQLSDEEERMREKMSIRKASALEWERFLLT
DFSAIIDLFQGQYASRLQCQVCEHTSTTYQTFSVLSVPVPRVKTCNILDCFREFTKCERL
GVDEQWSCPKCLKKQPSTKQLKITRLPKKLIINLKRFDNQMNKNNVFVQYPYSLDLTPYW
ARDFNHEAIVNEDIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYKGPKKGWYFFDDS
LYRPITFSTEFITPSAYVLFYERIF
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgggctcagaacaagccttaagtgaggttgtcgaatctgctaaagagcggttcggcagg
cttaggcatttagttcagaagtttcttgatgatgacgacgtgccacaagagtgtctgcct
ttgctccaagaatgcgcagaaatatggtctagttatgtggacgcatgccaggatataacc
atgcaggcccctaaagaagatgcaaaccggttgtcaaaggggtttctccgattgaatgaa
acagcttttttatattacatgatcgtatatacgctcttggaggatactctaccaagacta
aaggaattttcgagcaacaaggaccagaatgttagaaatttgtacggggagagaatccag
cttttgcataatgacccaaatattgagcggattcgaaatgtcattgaaaattaccctaaa
tttatacagttgcaaactatagagcctggaaaattaagttcaatgttgcattttcatggt
gacgctctcttgcttatcgatgtacggcccaggtctgaattcgttagggcccatatcaaa
tgcaaaaacattatatgcatcgatcctgcctcatttaaggattcttttacagaccaacaa
attgaaagtgtctctttgatcacttcgccgcactcagatatcactttcttttcaaatcga
gacaagttcaagttcattattttatatactgacactcaattgcataataatttccagcaa
aggcaaactcgcatccttgcgaagattctttcccaaaattcagtaattaaaccgctgagt
gggacgaaaatactcattttggaaaatgggttctcaaactgggttaaattaggtggggcg
tatcaatcatctgtcagtgaaacagcgcatcttacatcctcgtcttcaacgccagctttt
ggtagtccgcaagtcccaacaggcttgttcaatcagaaatctctatctccaaataaagat
aagagtatgccgatggtatccatgaatacgcagcctttgctaacaacggtgcaaaggcct
caattacccttatactattcagatttgcccattataccgcaaccaagccccaacagaaat
tctcccaccgttcaaaaatttagtccacatccaccaaccactctctcaaaactcaataca
ccctcgaccattcaaaataaagcaaacactgtggaaagaatatcgccagatatccgcgct
gcacaagcccatgcctatttgccccctgcatcgaatgtattctcgccacgtattccgcct
ttaccacaacagaacttgtcttcgtcgaggcagaccatcctaaacaactcacaagtgctt
gatctagatcttatagtaggattggaaaatataggtaactgttgttatatgaactgtata
cttcaatgtttggtgggaacacacgatttggttcgaatgtttttggataacacatatctg
aattttattaattttgatagttcaagaggttctaaggggttgctagctaaaaatttcgcc
atcttggtcaataatatgcacagacacggtgcattcacacctcctaacgtaagaacgata
ccagttcagactattcagtttaaaaaaatttgcggccatatcaaccccatgtatagtgat
tcaatgcagcaagattgtcaagaattttgtcaatttttgcttgatggcttgcacgaggat
ttgaaccaaaacggcagcaaaaagcatcttaaacagttatcagatgaggaagaacgaatg
agagaaaaaatgtccatacgcaaagctagtgctctcgagtgggaaagatttttgcttacc
gacttcagtgcgataattgaccttttccaaggacagtacgcatctaggctacaatgtcaa
gtttgtgaacatacctccacaacttaccaaacattctctgttctttctgttcctgtccca
cgcgttaaaacttgtaacatattagactgtttccgggaattcaccaaatgcgaaaggtta
ggtgtcgatgaacaatggtcatgtcctaaatgcttaaaaaagcagccttccactaaacaa
ctgaagattactagattgcctaagaaactaattattaatttgaaacgatttgacaatcaa
atgaataagaataatgtgtttgtccaatatccttactccttagatcttacaccatattgg
gcgagagattttaatcatgaagctattgttaatgaggacattcctaccaggggccaagta
ccaccatttagatacagactgtatggggttgcatgtcattcggggagtttgtatggggga
cactatacttcatacgtttataagggaccaaaaaaaggttggtattttttcgatgactcg
ctttatcgtcctataacgtttagtactgaatttatcacacccagtgcatatgttttattt
tacgaaagaattttttga

DBGET integrated database retrieval system