KEGG   Saccharomyces cerevisiae (budding yeast): YER151CHelp
Entry
YER151C           CDS       T00005                                 

Gene name
UBP3, BLM3
Definition
Ubp3p (EC:3.4.19.12)
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     YER151C (UBP3)
Peptidases [BR:sce01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YER151C (UBP3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
V:complement(469686..472424)
Genome map
AA seq 912 aa AA seqDB search
MNMQDANKEESYSMYPKTSSPPPPTPTNMQIPIYQAPLQMYGYTQAPYLYPTQIPAYSFN
MVNQNQPIYHQSGSPHHLPPQNNINGGSTTNNNNINKKKWHSNGITNNNGSSGNQGANSS
GSGMSYNKSHTYHHNYSNNHIPMMASPNSGSNAGMKKQTNSSNGNGSSATSPSYSSYNSS
SQYDLYKFDVTKLKNLKENSSNLIQLPLFINTTEAEFAAASVQRYELNMKALNLNSESLE
NSSVEKSSAHHHTKSHSIPKHNEEVKTETHGEEEDAHDKKPHASKDAHELKKKTEVKKED
AKQDRNEKVIQEPQATVLPVVDKKEPEESVEENTSKTSSPSPSPPAAKSWSAIASDAIKS
RQASNKTVSGSMVTKTPISGTTAGVSSTNMAAATIGKSSSPLLSKQPQKKDKKYVPPSTK
GIEPLGSIALRMCFDPDFISYVLRNKDVENKIPVHSIIPRGIINRANICFMSSVLQVLLY
CKPFIDVINVLSTRNTNSRVGTSSCKLLDACLTMYKQFDKETYEKKFLENADDAEKTTES
DAKKSSKSKSFQHCATADAVKPDEFYKTLSTIPKFKDLQWGHQEDAEEFLTHLLDQLHEE
LISAIDGLTDNEIQNMLQSINDEQLKVFFIRNLSRYGKAEFIKNASPRLKELIEKYGVIN
DDSTEENGWHEVSGSSKRGKKTKTAAKRTVEIVPSPISKLFGGQFRSVLDIPNNKESQSI
TLDPFQTIQLDISDAGVNDLETAFKKFSEYELLPFKSSSGNDVEAKKQTFIDKLPQVLLI
QFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSSITLKNNTSGID
DRRYKLTGVIYHHGVSSDGGHYTADVYHSEHNKWYRIDDVNITELEDDDVLKGGEEASDS
RTAYILMYQKRN
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcaagacgctaacaaagaagagtcgtactcgatgtacccgaaaacctcttct
ccaccaccacctacgccaaccaatatgcagattcctatttatcaagcgcctttgcagatg
tacggctacactcaggccccatatctataccccacacaaatacctgcctattcgtttaat
atggtcaaccaaaaccagccaatctaccatcaaagtggcagcccacatcacttgcctccg
caaaacaatattaacggcggaagcactaccaataacaacaacattaacaagaagaagtgg
cactctaatggcattaccaataacaatggaagcagcggtaatcaaggcgccaactctagc
ggtagcggcatgagctacaacaaatcccacacctaccatcacaattactctaacaatcat
atccccatgatggcctctccaaacagtggcagcaatgcgggcatgaaaaaacagaccaac
tcttccaacggcaacggttcttcggctacttcaccatcgtactcttcctacaactcttct
tcacagtatgatttatacaagtttgatgtcactaaattaaagaatctcaaggaaaattca
tcaaacttgattcaattgccactgttcataaacactacggaagcagaatttgctgcggca
agtgtccaaaggtacgaattaaacatgaaggctttgaacctaaactctgaaagcttagag
aactcatctgtagaaaagagctctgcccatcatcacacaaaaagccatagtataccaaag
cataatgaggaagtaaagacagaaacacatggggaagaagaagatgctcatgataaaaaa
ccacatgcgagcaaagatgcgcacgagcttaaaaagaaaactgaagtaaagaaagaggat
gctaagcaagaccgtaacgaaaaagttatacaggaacctcaagctactgttttacctgta
gtggataagaaggaaccagaggaatctgttgaagaaaatacttccaagacatcttcacct
tcaccatctcctccagcagcaaaatcctggtccgccatagcatcagatgcgattaaaagt
agacaagctagtaacaaaacagtctccggatcgatggtcactaaaacaccaatttctggt
acgaccgcaggcgtttcatcaacaaacatggctgcggcgactataggtaaatccagctct
cccctgttgtccaagcagcctcagaaaaaggataaaaaatacgttccaccttctacaaag
ggtattgagccactgggttcgattgcgttaagaatgtgttttgatcccgatttcattagt
tacgttttacggaataaagatgttgaaaacaaaataccagtccattccattattccaaga
ggcataattaacagagccaacatttgttttatgagttctgtgttacaagtgttactctac
tgtaagccatttattgatgtaattaacgttctcagtacacggaataccaattcaagagtc
ggcacatcatcctgtaaattattagatgcttgtttgactatgtataagcaattcgataag
gaaacctatgagaaaaaattcctagagaatgctgatgatgctgaaaaaaccacggaaagt
gatgcaaaaaaatcatcaaaatccaagagtttccaacactgcgccactgccgatgctgtc
aaacctgacgaattttacaaaactttgtctactataccgaagttcaaagacttgcaatgg
ggccatcaggaagacgcagaagaatttttgacccacttattggaccaattacacgaggaa
ttaatttctgcaattgatggcttaaccgataatgaaattcaaaatatgctgcaaagtatt
aatgatgaacaattgaaagttttctttattagaaatttgtcacgttatggaaaagcagag
tttatcaaaaatgctagtcctagactgaaggagttgatagaaaaatatggcgtgatcaat
gatgactctaccgaagaaaatggttggcatgaagtgagcggatctagcaaaagaggcaag
aaaactaagaccgctgccaagaggactgtcgagattgttccatcaccaatctccaaactt
ttcggtggccagttcagatctgtgttagatataccgaacaataaggaatctcaatcgatt
acactcgatccgttccaaacaattcaattggacatttcagatgctggtgtgaatgatcta
gaaactgcattcaaaaaatttagtgaatacgaattgctaccctttaagtcctcgtcaggg
aatgatgtcgaggccaagaagcagacttttattgataaattgccgcaagttcttttaatc
caattcaaaagattctcattcataaataatgtgaacaaagacaacgcaatgacgaactat
aacgcgtacaatggacgtattgagaagatcaggaaaaaaattaaatatggtcacgagtta
atcatacctgaagaatcaatgtcttccataacattgaaaaacaacacctcagggattgat
gatagaagatataagctaaccggagttatataccatcatggggtaagttccgatggcggt
cattacacagcggatgtttatcatagcgagcacaacaaatggtatagaatagatgatgta
aatattaccgaactagaggacgatgacgttttgaaaggtggcgaagaagcttctgattcg
aggactgcctatattttaatgtatcaaaagagaaattaa

DBGET integrated database retrieval system