KEGG   Saccharomyces cerevisiae (budding yeast): YER173WHelp
Entry
YER173W           CDS       T00005                                 

Gene name
RAD24
Definition
Rad24p
Orthology
K06662  
cell cycle checkpoint protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
V:536300..538279
Genome map
AA seq 659 aa AA seqDB search
MDSTNLNKRPLLQYSLSSLGSQITKWSSSRPTSPVRKARSTENDFLSKQDTSSILPSIND
DGGEQWYEKFKPNCLEQVAIHKRKLKDVQEALDAMFLPNAKHRILLLSGPSGCSKSTVIK
ELSKILVPKYRQNSNGTSFRSTPNEHKVTEFRGDCIVNDLPQMESFSEFLKGARYLVMSN
LSLILIEDLPNVFHIDTRRRFQQLILQWLYSSEPLLPPLVICITECEIPENDNNYRKFGI
DYTFSAETIMNKEILMHPRLKRIKFNPINSTLLKKHLKFICVQNMKMLKEKNKWNKRQEV
IDYIAQETGDIRSAITTLQFWATSSGSLPISTRESTISYFHAIGKVIHGSHSTNNDNEMI
NNLFENSNNLLSKEDFKLGILENYNTFNKGEFSISDASSIVDCLSECDNMNGLPESNEYG
LREVRKTFRNISKQGHNHGTVYFPREWKVRKLQNSFKVQAEDWLNVSLYKYNAVHSFRNI
TLEFGYYAPLIRKCQSYKKKYILYYLKNLPSGSSGPKQTMDKFSDIMKVENGIDVVDRIG
GPIEALSVEDGLAPLMDNDSNNCDHLEDQKKERDRRLRMLIDQYERNVMMANDDLEDEET
SFNDDPIVDSDSDNSNNIGNETFGRSDEDESLCEILSQRQPRKAPVISESLSDSDLEIL
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggatagtacgaatttgaacaaacggcccttattacaatatagtctcagttcattgggc
tcgcaaataacaaaatggagctcatctagaccgacttcgccagttcgtaaggcgagaagc
actgaaaatgactttctttccaagcaagatacgtctagtatcctcccaagtatcaacgac
gacggcggtgaacagtggtacgaaaagttcaagcccaattgtttggagcaagtggccata
cataaaagaaaacttaaagatgtacaagaagctttagatgccatgtttttacctaacgcc
aagcataggatcctactactgtctggccccagtggatgctctaaaagtacggtcataaaa
gaactctcaaaaatcttagttcctaaatacagacaaaacagcaacggaacgtcctttcga
agcaccccgaacgagcataaagtgaccgagtttagaggtgattgtatagtcaacgatctt
cctcagatggaaagctttagtgagttcttaaaaggcgcacggtatcttgtgatgtccaac
ctgtcattaatacttatcgaggaccttcccaacgtcttccatatagataccagacgtcga
tttcaacaacttatattacagtggctatatagttcggagcctctattacctccccttgtt
atatgtataactgaatgtgaaattccagagaacgataataattatcgcaaatttggtatt
gattatacatttagtgcagaaaccataatgaacaaagaaatattgatgcatccaaggttg
aaaagaattaagtttaatccaattaacagcactttattaaaaaagcacttgaaatttatt
tgtgtacagaatatgaaaatgttgaaggagaaaaataaatggaataaaagacaggaagtc
atagattatattgcgcaagagactggtgatattaggtcggccattacgacccttcaattt
tgggcgacatcaagtggaagtttgccgatttcaacccgagaatccaccatatcatacttt
catgccattgggaaggtgatacatggttcccatagcacgaataacgataacgaaatgatt
aataacctcttcgaaaattcgaacaatttgttatcgaaagaggatttcaaattaggaata
ttagagaactataacacatttaataaaggcgaattcagcatttctgatgcatcatcaatt
gtggattgcctgagcgagtgtgataatatgaatggtctaccagaatccaatgagtatggt
ttacgagaagtgcgcaaaacctttcgtaacatcagtaaacaaggccataatcatggaacg
gtttattttccaagagaatggaaagtaagaaaattacaaaattcatttaaagttcaagct
gaagattggttaaatgttagtctttataagtacaacgcggtacattctttcaggaatata
actctagaatttggctactacgcacctctaattagaaagtgtcagagttataaaaaaaaa
tacattctctattatttgaagaatcttccgagtggctcctcggggcccaaacaaaccatg
gacaaatttagtgatataatgaaagttgagaacggaatcgacgttgtggatcggataggc
gggcctatcgaagcactatctgtggaggatggactagcaccattgatggataatgatagc
aataattgtgaccatttagaggatcaaaaaaaggaaagggacagaaggcttcgcatgttg
attgaccaatatgaaagaaatgtgatgatggctaacgacgatcttgaagacgaagaaact
tcttttaatgatgaccctattgtcgatagcgatagcgataacagcaataatattggcaat
gaaacatttggtagaagcgacgaagacgagtctctatgtgaaattctgtcccagagacag
ccgcgtaaagcgccagttatcagtgagtccctttcagattcagatctggaaatactctaa

DBGET integrated database retrieval system