KEGG   Saccharomyces cerevisiae (budding yeast): YFL008WHelp
Entry
YFL008W           CDS       T00005                                 

Gene name
SMC1, CHL10
Definition
cohesin subunit SMC1
Orthology
K06636  
structural maintenance of chromosome 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VI:119429..123106
Genome map
AA seq 1225 aa AA seqDB search
MGRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSN
ILKDLIYRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYK
IDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEEVSGSIQYKK
EYEELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQLDKKNELQKFQALW
QLYHLEQQKEELTDKLSALNSEISSLKGKINNEMKSLQRSKSSFVKESAVISKQKSKLDY
IFKDKEKLVSDLRLIKVPQQAAGKRISHIEKRIESLQKDLQRQKTYVERFETQLKVVTRS
KEAFEEEIKQSARNYDKFKLNENDLKTYNCLHEKYLTEGGSILEEKIAVLNNDKREIQEE
LERFNKRADISKRRITEELSITGEKLDTQLNDLRVSLNEKNALHTERLHELKKLQSDIES
ANNQEYDLNFKLRETLVKIDDLSANQRETMKERKLRENIAMLKRFFPGVKGLVHDLCHPK
KEKYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIETELPTLSLP
DSQDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKGIRGKLVTIEGALIH
KAGLMTGGISGDANNRWDKEEYQSLMSLKDKLLIQIDELSNGQRSNSIRAREVENSVSLL
NSDIANLRTQVTQQKRSLDENRLEIKYHNDLIEKEIQPKITELKKKLDDLENTKDNLVKE
KEALQNNIFKEFTSKIGFTIKEYENHSGELMRQQSKELQQLQKQILTVENKLQFETDRLS
TTQRRYEKAQKDLENAQVEMKSLEEQEYAIEMKIGSIESKLEEHKNHLDELQKKFVTKQS
ELNSSEDILEDMNSNLQVLKRERDGIKEDIEKFDLERVTALKNCKISNINIPISSETTID
DLPISSTDNEAITISNSIDINYKGLPKKYKENNTDSARKELEQKIHEVEEILNELQPNAR
ALERYDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYR
ELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALA
LLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDA
LVGVYRQQQENSSKIITLDLSNYAE
NT seq 3678 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtttagttggcttagaactaagtaatttcaagtcctatagaggcgttaccaag
gtaggattcggcgagtcgaatttcacaagtattatcggtcctaacggatctggtaaatcg
aatatgatggatgctatctcattcgtactcggtgtgcggagtaatcatttgaggtcaaac
atcttgaaagatttaatctatagaggtgttctaaacgatgagaatagtgacgattatgat
aacgagggcgctgcctcttcgaacccacaatccgcatacgtgaaggcattttatcaaaaa
ggtaacaaactggtggagctgatgaggataatttccagaaacggtgacactagttataaa
attgatggaaaaactgtctcctataaggactattctatatttcttgagaacgaaaatatt
cttatcaaagccaaaaattttctagtgttccagggtgatgttgagcaaattgcagcacaa
tctcccgtagaattatcaagaatgtttgaagaagtatcaggttctatccaatacaaaaag
gagtatgaagagttgaaggaaaagattgagaaattaagcaaatctgcaaccgaatctata
aaaaataggagaaggatccatggagaattgaagacatataaagaaggtatcaataagaac
gaggagtataggaaacaattggacaaaaaaaatgaattacagaagttccaggctctatgg
cagttatatcatttagagcaacaaaaagaggagctaacggacaagctgtccgcattaaac
tctgaaatatcgtctttaaagggaaaaataaataacgagatgaaatcattacaacgctca
aaatcttcctttgttaaagaaagcgcagtaatttctaagcaaaaaagtaaattagattat
atcttcaaggataaggaaaaattagtctcggatttacggctcataaaggttcctcaacag
gcagcagggaagcgaatttcccatatagaaaaaagaatcgaaagtttacagaaagatctt
caaagacagaagacttatgtggagagatttgaaacacaactaaaagtggtgaccagatca
aaggaagcttttgaagaggaaatcaaacaatctgctagaaactatgacaaattcaagcta
aatgaaaatgatttaaagacatataattgcttacatgaaaaatatctgactgaaggtggg
tcaatcctagaagaaaaaattgccgttttgaacaacgataagcgagaaatccaagaggaa
ttggagagattcaacaaaagggcagatatttctaaaagaaggataacggaggagctttct
ataacaggagaaaaattggacacgcaattaaacgatttaagagtttctttgaatgagaaa
aacgcccttcatactgaacgtttgcacgagctgaaaaaattacaatctgatattgaatct
gctaataatcaagaatacgacttaaatttcaagttgagggaaacgttggttaagatcgat
gacttgagtgctaatcaaagagaaacaatgaaagaaagaaaactaagagaaaatatagca
atgttgaaaagattcttccccggagtaaaaggtcttgttcatgatctttgtcacccaaaa
aaggagaaatatggcttggcagtgtctaccatcttaggtaagaactttgattccgtcatt
gtagaaaatttaaccgtagctcaagaatgcattgcatttttgaagaagcaacgtgcgggc
actgcatctttcataccactagacacaattgagacagagttacctacattatcattgcct
gactcacaagactatattttatcaattaatgctattgactacgagccggaatatgaaaaa
gcgatgcaatatgtgtgtggcgattccatcatatgtaatacgttgaatattgctaaagat
ctgaaatggaaaaagggcataagaggcaaattggttacaattgaaggtgctttgatccac
aaggccggtttgatgacaggtggtatatcaggagatgccaataataggtgggataaagaa
gaatatcaaagcttaatgtctttaaaagacaaattactaatccaaatcgatgaactttcc
aacggtcaacgctctaattcaatcagagcaagagaagttgaaaatagtgtttcactattg
aactcggacatagcaaatttgagaactcaagtaacacaacaaaaacgctccttggatgaa
aatcgtttagagattaagtaccataatgacttgatagagaaagaaattcaaccgaagata
actgaactaaagaagaagctagatgatttagaaaatactaaagataatttagtgaaagag
aaggaggctttacaaaataatattttcaaagaattcactagtaaaattggctttacaatc
aaagaatatgaaaatcattccggtgaattgatgagacaacaatctaaagaattacagcag
ttacaaaaacaaattttgaccgttgaaaataagttgcagtttgagacagacagactaagt
actactcaaagaagatatgaaaaggcgcaaaaggatttagagaatgctcaagttgaaatg
aagtctttggaagaacaggaatatgcaatagaaatgaaaatcggatcaatagagtctaaa
ttggaagaacacaaaaatcacttagatgagttacagaagaaatttgtaacgaagcaaagt
gaattaaattccagcgaagatattctagaggacatgaacagcaacttacaagtcttaaaa
agggaaagagacggtataaaggaagatattgaaaagtttgatttagagagagtaacagcg
ttaaagaattgtaaaatttctaatataaatatacctatatcatctgaaacaacgatagat
gatttaccaatatcttccactgataatgaagcaattacaatttccaacagtatcgatata
aactataaaggactacctaaaaaatacaaagaaaacaataccgattcggcaaggaaggag
ctggagcagaagattcatgaagtggaggaaatattgaacgagttgcagcccaatgcaaga
gctttggagagatacgacgaggcggaaggaaggtttgaagtgattaataacgaaacagaa
caactaaaggccgaagaaaagaaaatattaaaccagttcctaaaaattaagaaaaaaaga
aaggaactgttcgaaaagacatttgattatgtgagcgaccatttagacgcaatctacagg
gaacttactaaaaatcccaactccaatgtggaattggccggtggtaacgcttctttaacc
atagaagacgaagatgaaccgttcaatgcgggaatcaaatatcatgccactccgcctctt
aaaagattcaaagacatggaatatctttctggtggtgaaaaaaccgtagctgcattagct
ctattatttgctattaattcctaccagcctagtcccttcttcgtgctggacgaagtggac
gcagccctagacattactaacgtccagagaattgctgcctatataagaaggcaccgtaat
ccagatctccaattcattgtcatttcattgaagaacaccatgtttgaaaaatctgacgct
ctcgttggggtttacagacagcaacaagaaaactcgtcgaagatcataactttggacttg
agcaattacgcagaataa

DBGET integrated database retrieval system