KEGG   Saccharomyces cerevisiae (budding yeast): YFL009WHelp
Entry
YFL009W           CDS       T00005                                 

Gene name
CDC4
Definition
SCF ubiquitin ligase complex subunit CDC4
Orthology
K03361  
F-box and WD-40 domain protein CDC4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Ubiquitin mediated proteolysis
Module
SCF-CDC4 complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YFL009W (CDC4)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YFL009W (CDC4)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    target recognizing subunit (F-box)
     YFL009W (CDC4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VI:116145..118484
Genome map
AA seq 779 aa AA seqDB search
MGSFPLAEFPLRDIPVPYSYRVSGGIASSGSVTALVTAAGTHRNSSTAKTVETEDGEEDI
DEYQRKRAAGSGESTPERSDFKRVKHDNHKTLHPVNLQNTGAASVDNDGLHNLTDISNDA
EKLLMSVDDGSAAPSTLSVNMGVASHNVAAPTTVNAATITGSDVSNNVNSATINNPMEEG
ALPLSPTASSPGTTTPLAKTTKTINNNNNIADLIESKDSIISPEYLSDEIFSAINNNLPH
AYFKNLLFRLVANMDRSELSDLGTLIKDNLKRDLITSLPFEISLKIFNYLQFEDIINSLG
VSQNWNKIIRKSTSLWKKLLISENFVSPKGFNSLNLKLSQKYPKLSQQDRLRLSFLENIF
ILKNWYNPKFVPQRTTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQLSG
HDGGVWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYI
VTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHG
NIVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLE
NIWNNGECSYATNSASPCAKILGAMYTLQGHTALVGLLRLSDKFLVSAAADGSIRGWDAN
DYSRKFSYHHTNLSAITTFYVSDNILVSGSENQFNIYNLRSGKLVHANILKDADQIWSVN
FKGKTLVAAVEKDGQSFLEILDFSKASKINYVSNPVNSSSSSLESISTSLGLTRTTIIP
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgtttcccttagctgagtttccattacgtgatatccctgttccttatagctac
cgtgtgtctggcggtatagcttcctcaggtagtgttactgcgcttgttactgccgctggc
actcatcgaaactcgtccacggctaagacagttgagacagaagacggcgaagaagatatc
gatgagtatcagaggaaaagagcagctggttctggcgaatccactcctgaacgcagtgat
ttcaaaagggtaaaacatgataatcacaaaaccctccatccagttaacttacagaacacc
ggtgcagcgtctgtggataatgacggtctgcacaatttaacagatatatccaacgatgca
gaaaaacttttgatgtctgtggatgatggttctgccgcaccttctacattgagtgtaaac
atgggagtggcatctcataatgttgctgctcccactaccgtcaatgcggcaacaataact
ggcagtgatgttagtaacaatgttaatagtgctactattaacaatcctatggaggaagga
gcgctgccgttatcacccactgcttcctctccaggtaccacaactcctttagctaaaact
acgaaaactatcaacaacaataataatatcgccgatttgatagaatccaaagattctata
atctcccctgaatacctttctgatgagattttcagcgcaataaacaataatctccctcac
gcatacttcaaaaatttattatttagattagttgccaacatggataggagtgaactatcc
gacttggggactttaatcaaggataatttaaagagggacctaataacgtctttgcctttt
gaaataagtttgaaaattttcaattatttgcaattcgaggatattataaattcccttggg
gtctcccaaaattggaacaaaataattagaaaatctacatcgttgtggaaaaaacttctg
atatcggaaaattttgtgagcccaaagggttttaattctctcaatctcaaactctcccaa
aaatacccaaaactctcacaacaagatcgccttagattatcttttctggagaatatattc
attttaaaaaattggtacaatcccaagtttgtaccacaaaggaccacgttaagaggccat
atgacgagtgttattacgtgcttgcaatttgaagataattatgtcattacgggggctgat
gacaaaatgatcagagtttatgattcgataaacaagaaatttcttctacaactatcaggt
catgatggtggggtttgggcattgaagtatgcccatggcggtattttagtcagcggttct
acagacagaacggtgcgagtttgggatattaagaaaggttgttgtacccatgtgtttaaa
ggtcataactctacggtgaggtgcctagatatagtagaatataaaaatatcaagtacatt
gttactggttcgagagataacactttgcacgtttggaaattgcccaaggagtcctccgtt
cctgatcatggggaagaacatgattatccattagtctttcatacccctgaggagaaccca
tattttgttggtgttttaagaggacatatggcatctgtaagaactgtctcaggccacggt
aatattgtcgttagtggctcctatgataatacactgattgtgtgggatgttgcgcaaatg
aaatgtttgtatattttaagtggacatacggatcgtatttattcgacaatctacgatcat
gaaagaaaaaggtgcatctctgccagtatggataccactattagaatttgggatttggaa
aatatatggaataatggagaatgttcctacgcaacaaattcagcatcgccatgcgccaaa
atacttggtgctatgtacactttgcagggtcatacagctttggtcggtttattaagatta
tccgacaaatttttggtcagtgccgctgcagacggttcaataaggggttgggacgcaaac
gactactctagaaaattttcctaccatcataccaatttgagtgcaattaccacattttat
gtatcggataatattttggtgagtggatcggaaaatcagttcaacatctataatctacgg
agtgggaaattggtccacgcaaatattctaaaagatgctgatcagatttggtcggttaat
tttaagggcaaaacacttgttgcagcagttgaaaaagatggacagagctttttagaaatt
ctggatttcagcaaagcttcaaaaattaactacgttagcaatcccgtaaactcctcgtcg
tcgtctttggaatccatttctacttctttgggtctaacgaggacaactataataccatga

DBGET integrated database retrieval system