KEGG   Saccharomyces cerevisiae (budding yeast): YFL029CHelp
Entry
YFL029C           CDS       T00005                                 

Gene name
CAK1, CIV1
Definition
Cak1p (EC:2.7.11.22)
Orthology
K06667  
serine/threonine-protein kinase CAK1 [EC:2.7.11.22]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YFL029C (CAK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     YFL029C (CAK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VI:complement(78055..79161)
Genome map
AA seq 368 aa AA seqDB search
MKLDSIDITHCQLVKSTRTARIYRSDTYAIKCLALDFDIPPHNAKFEVSILNKLGNKCKH
ILPLLESKATDNNDLLLLFPFEEMNLYEFMQMHYKRDRRKKNPYYDLLNPSIPIVADPPV
QKYTNQLDVNRYSLSFFRQMVEGIAFLHENKIIHRDIKPQNIMLTNNTSTVSPKLYIIDF
GISYDMANNSQTSAEPMDSKVTDISTGIYKAPEVLFGVKCYDGGVDVWSLLIIISQWFQR
ETSRMGHVPAMIDDGSDDMNSDGSDFRLICSIFEKLGIPSIQKWEEVAQHGSVDAFVGMF
GADGDGKYVLDQEKDVQISIVERNMPRLDEIADVKVKQKFINCILGMVSFSPNERWSCQR
ILQELEKP
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggatagtatagacattacacactgtcagttggtcaaatctactagaactgct
aggatttataggtcggatacatatgccattaaatgtctagcactagatttcgatatcccg
ccacataacgccaaattcgaagtatcgatattaaacaaactgggcaacaaatgtaagcac
atcttacctcttctagagtctaaggctaccgataataatgacctattgttgttgtttccc
tttgaagagatgaacctttatgagttcatgcaaatgcactataaaagagatagaagaaaa
aaaaatccctattacgatttgctaaatcccagtatcccaattgttgcggacccccccgtt
cagaaatatactaatcaattggacgtcaatcggtattctttgtcctttttccggcaaatg
gttgaagggattgcattcttacatgagaacaagatcattcaccgcgacatcaaaccgcaa
aatatcatgctaacaaacaataccagcaccgtatccccaaagttgtacataattgatttt
ggcatctcttatgacatggcaaataactcacaaacaagtgcggaacccatggatagcaag
gtgacggatataagcacaggaatttacaaggccccagaagtgctttttggagtaaaatgc
tatgatggtggcgtggacgtgtggtcgttgttgataattatttctcagtggttccagaga
gaaacaagccgtatggggcacgttccggccatgattgatgacggcagcgacgacatgaac
tcagatggaagcgatttcagactgatttgctcaatattcgaaaagttgggcataccgtcc
attcagaaatgggaagaggttgcgcaacacggctcggttgatgcatttgttggtatgttt
ggtgcagatggcgatggcaagtatgtactggaccaggagaaagatgtacagattagcatt
gttgagaggaatatgcctcgactggacgagattgcggatgtcaaagtcaagcagaagttc
attaattgtatcctggggatggtttcattttcaccaaacgaaagatggagctgtcaaaga
atcttgcaagaattagaaaagccataa

DBGET integrated database retrieval system