KEGG   Saccharomyces cerevisiae (budding yeast): YFR010WHelp
Entry
YFR010W           CDS       T00005                                 

Gene name
UBP6
Definition
Ubp6p (EC:3.4.19.12 3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VI:165067..166566
Genome map
AA seq 499 aa AA seqDB search
MSGETFEFNIRHSGKVYPITLSTDATSADLKSKAEELTQVPSARQKYMVKGGLSGEESIK
IYPLIKPGSTVMLLGTPDANLISKPAKKNNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYL
NATLQALYRVNDLRDMILNYNPSQGVSNSGAQDEEIHKQIVIEMKRCFENLQNKSFKSVL
PIVLLNTLRKCYPQFAERDSQGGFYKQQDAEELFTQLFHSMSIVFGDKFSEDFRIQFKTT
IKDTANDNDITVKENESDSKLQCHISGTTNFMRNGLLEGLNEKIEKRSDLTGANSIYSVE
KKISRLPKFLTVQYVRFFWKRSTNKKSKILRKVVFPFQLDVADMLTPEYAAEKVKVRDEL
RKVEKEKNEKEREIKRRKFDPSSSENVMTPREQYETQVALNESEKDQWLEEYKKHFPPNL
EKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESL
AGGGESDSALILMYKGFGL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagcggagaaacgtttgagttcaatattagacattctggtaaagtttacccaataaca
ctttccactgatgctacttcagcagatttgaaaagcaaagcagaggaattgacccaagtc
ccaagtgcccgccaaaaatacatggttaaaggtggcttgtctggcgaagagtccattaaa
atatatcccttaatcaagccaggatcgacagtaatgctattggggactccagatgctaac
ctgatttctaaaccagccaaaaagaataatttcattgaagaccttgcgcctgagcaacaa
gtccaacaatttgctcaattgcctgttggtttcaagaatatgggcaacacctgttatctg
aatgctaccctacaggctttatacagagtgaacgatttaagggatatgattcttaattat
aacccttctcaaggtgtgtctaacagtggtgcacaagatgaagagattcacaaacaaatc
gttattgaaatgaagcgttgttttgaaaatttacagaataaaagtttcaagagtgttttg
ccaattgtgttattaaacacgctaagaaagtgttatccacaatttgctgaacgtgattca
caaggtgggttctataaacagcaagacgctgaggagttgtttacacaactattccatagt
atgagtattgtttttggtgacaaattttccgaagatttcaggattcaatttaaaactacc
atcaaagacacagctaatgataacgatattactgttaaagaaaatgaaagcgattctaaa
ttacaatgtcatatttctggtactacaaatttcatgagaaatgggctcctggaaggtttg
aatgagaaaattgaaaaaagatcagacttgactggcgccaattccatctatagcgtcgaa
aagaaaatatcaagattaccaaagtttttaactgttcagtacgttagatttttctggaaa
aggtcaaccaacaaaaaatctaaaatattgcgtaaggtcgttttcccatttcaattagat
gttgcagacatgcttaccccagaatacgcagcagagaaggtaaaagttcgtgacgaactg
agaaaagttgaaaaggagaaaaatgaaaaggaaagagagatcaaaaggcgtaaatttgac
ccatcatccagtgaaaatgtcatgacaccaagagaacaatatgagacacaagtggctctt
aacgaaagtgaaaaagatcaatggctcgaagagtataagaaacattttcctccaaacttg
gaaaaaggtgaaaacccatcttgtgtttataacttgatcggtgtcattacacatcaaggt
gccaattctgagtctggacactatcaagctttcataagggacgaactggacgaaaataaa
tggtacaaatttaatgatgataaagttagcgttgttgaaaaggaaaaaattgaatcttta
gccggtgggggcgaaagtgatagtgcactgatcttaatgtataaaggatttggtctgtaa

DBGET integrated database retrieval system