KEGG   Saccharomyces cerevisiae (budding yeast): YFR015CHelp
Entry
YFR015C           CDS       T00005                                 

Gene name
GSY1
Definition
glycogen (starch) synthase GSY1 (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YFR015C (GSY1)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     YFR015C (GSY1)
Glycosyltransferases [BR:sce01003]
 Polysaccharide
  Storage polysaccharide
   YFR015C (GSY1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VI:complement(174265..176391)
Genome map
AA seq 708 aa AA seqDB search
MARDLQNHLLFEVATEVTNRVGGIYSVLKSKAPVTVAQYGDNYTLLGPLNKATYESEVEK
LDWEDESIFPEELLPIQKTLMSMREKGVNFVYGNWLIEGAPRVILFELDSVRHFLNEWKA
DLWSLVGIPSPEHDHETNDAILLGYVVVWFLGEVSKLDSSHAIIGHFHEWLAGVALPLCR
KKRIDVVTIFTTHATLLGRYLCAAGDVDFYNNLQYFDVDQEAGKRGIYHRYCIERAAAHT
ADVFTTVSQITALEAEHLLKRKPDGILPNGLNVVKFQAVHEFQNLHALKKDKINDFVRGH
FHGCFDFDLDNTVYFFIAGRYEYKNKGADMFIESLARLNYRLKVSGSKKTVVAFLIMPAK
TNSFTVEALKSQAIVKSLENTVNEVTASIGKRIFEHTMRYPHNGLESELPTNLDELLKSS
EKVLLKKRVLALRRPYGELPPVVTHNMCDDANDPILNQIRHVRLFNDSSDRVKVIFHPEF
LNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNVSGFGAYMEDL
IETDQAKDYGIYIVDRRFKSPDESVEQLADYMEEFVNKTRRQRINQRNRTERLSDLLDWK
RMGLEYVKARQLGLRRAYPEQFKQLVGETISDANMNTLAGGKKFKIARPLSVPGSPKVRS
NSTVYMTPGDLGTLQDANNADDYFNLSTNGAIDNDDDDNDTSAYYEDN
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgacttacaaaatcatctactgttcgaagtagcaacagaagtaactaacagg
gttggtggtatttactctgtcttgaagtccaaggctccagtcactgtggcacaatacgga
gacaactatacgctgcttggacctttgaacaaggcgacttatgaaagtgaggttgaaaaa
cttgactgggaagatgaaagtatctttcctgaagagctgttaccgatccaaaaaactttg
atgtccatgcgggaaaagggtgtgaactttgtctacggtaactggttgattgagggagca
ccacgtgtcattttatttgagctggattctgtaagacactttttgaacgaatggaaggct
gacctatggtctctcgtcggaattccatcaccagagcatgatcacgaaacaaacgatgcc
atattgttgggttatgttgttgtgtggtttttgggagaagtttcaaaactggacagtagc
catgccatcattggccatttccatgaatggctagctggtgtagccctgccattgtgtaga
aagaaaagaattgatgttgtaacgattttcaccacgcacgcaactttattgggtagatac
ttgtgtgccgctggtgatgtagatttttataacaatctacagtattttgatgtggaccaa
gaagctggtaagagaggcatatatcataggtactgcattgagcgcgctgcggctcatact
gccgatgtttttacgactgtgtcgcaaatcactgcattagaagcggagcatttgttgaag
aggaaaccggatggcattttgcccaatggtttgaacgttgttaagtttcaagcagtacat
gaatttcaaaatctgcatgccctgaaaaaggacaaaattaatgatttcgtcagaggccat
ttccatggttgttttgatttcgatctagacaacacagtttatttctttatcgctggtaga
tatgaatacaaaaacaaaggtgctgacatgttcattgaatcattggctcgtctcaattac
agattgaaggtttctggatccaagaagacggtggtagcgtttttgatcatgcctgccaaa
accaattccttcactgtggaggcactgaaaagccaagccattgtaaaatctttggaaaat
actgttaatgaggtcaccgcatccattgggaagagaattttcgagcatacgatgagatac
cctcataatggcctagaatcagagttgcccactaatttagatgagctgttgaagagttct
gaaaaggttttgctgaagaaaagggtattggcgctgagaagaccttacggggaattgcct
ccggtagtcacacataacatgtgcgatgatgctaacgatccaattttaaaccaaattaga
catgttagattattcaatgattcgagtgatcgtgtaaaagtgattttccatcctgaattc
ttaaacgccaataaccctatccttggtttggattatgacgagtttgttcgcggctgtcac
ttgggtgtttttccatcctattacgaaccatgggggtacacgccagcagaatgtaccgtc
atgggtgtcccatctatcacaacaaacgtttctgggttcggtgcctacatggaagacttg
attgaaacagaccaagcgaaagactatggtatttatattgtagaccgtcgtttcaagagc
cctgatgaatctgtcgagcaattagcagactacatggaagagtttgtaaacaagaccaga
agacaaagaatcaaccaaagaaacagaaccgaaagactatcagacttgttagattggaag
agaatggggttggaatacgttaaggctagacagttgggtcttcgtagggcctatccagag
cagttcaagcaactggtgggtgaaacaattagtgacgccaatatgaatactcttgccggt
ggcaagaaattcaagattgccaggcctttgagtgtacccggatcccccaaagtaaggtcc
aatagtactgtttacatgactccgggcgatttaggtacccttcaagatgctaataatgca
gatgactattttaatttgagcacgaatggagccatcgacaatgacgatgatgacaacgat
acgtctgcatactacgaggataattaa

DBGET integrated database retrieval system