KEGG   Saccharomyces cerevisiae (budding yeast): YFR028CHelp
Entry
YFR028C           CDS       T00005                                 

Gene name
CDC14, OAF3
Definition
Cdc14p (EC:3.1.3.48)
Orthology
K06639  
cell division cycle 14 [EC:3.1.3.16 3.1.3.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YFR028C (CDC14)
   04113 Meiosis - yeast
    YFR028C (CDC14)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     YFR028C (CDC14)
    3.1.3.48  protein-tyrosine-phosphatase
     YFR028C (CDC14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VI:complement(208413..210068)
Genome map
AA seq 551 aa AA seqDB search
MRRSVYLDNTIEFLRGRVYLGAYDYTPEDTDELVFFTVEDAIFYNSFHLDFGPMNIGHLY
RFAVIFHEILNDPENANKAVVFYSSASTRQRANAACMLCCYMILVQAWTPHQVLQPLAQV
DPPFMPFRDAGYSNADFEITIQDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNV
LTPDFIAFASPQEDHPKGYLATKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFE
DIGIQHLDLIFEDGTCPDLSIVKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIY
TYGFTANECIGFLRFIRPGMVVGPQQHWLYLHQNDFREWKYTTRISLKPSEAIGGLYPLI
SLEEYRLQKKKLKDDKRVAQNNIEGELRDLTMTPPSNGHGALSARNSSQPSTANNGSNSF
KSSAVPQTSPGQPRKGQNGSNTIEDINNNRNPTSHANRKVVIESNNSDDESMQDTNGTSN
HYPKVSRKKNDISSASSSRMEDNEPSATNINNAADDTILRQLLPKNRRVTSGRRTTSAAG
GIRKISGSIKK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaggagtgtatacctcgacaacacgatcgagttcctgcgaggcagagtatatctc
ggtgcatatgattacacgccggaagatactgatgagctggtgttttttaccgtggaggac
gcaatcttttacaacagtttccatttggatttcggtcccatgaacattggacatctatat
cgttttgccgttattttccatgaaatcttgaatgacccagaaaatgccaataaagccgtt
gttttctattcatctgcatcgaccagacaacgtgctaacgccgcatgtatgctttgctgt
tatatgatcctcgttcaggcatggactccgcatcaagtgcttcagccgttggcgcaagta
gaccctcccttcatgccatttagagatgccggttattctaatgcggatttcgaaatcaca
attcaagatgtggtttatggcgtttggagggctaaggaaaaaggccttattgatttgcat
tccttcaatttggagagttacgagaaatacgaacacgtggagtttggagacttcaatgta
ctcaccccagattttattgcatttgcgtcaccacaagaggaccatccaaagggctatctc
gctaccaaatcttcacatttgaaccagccgtttaagtcagttctgaattttttcgccaac
aataacgtccaattagtggtaaggttgaattctcatttatataataaaaagcattttgaa
gacattggcattcaacatttggatctaattttcgaagatggtacatgtcctgatctttcc
attgtaaaaaactttgttggtgctgctgaaacgataattaaaaggggaggtaaaattgct
gtgcactgtaaggctgggctaggtagaactggttgtttaattggtgctcacttaatatac
acgtatggatttaccgctaacgagtgtattggcttcttaaggtttataaggccgggaatg
gtcgttggccctcaacagcattggttatatttacaccagaatgattttagagaatggaag
tacacaaccagaatttctttgaagcctagtgaggccattggcggcttatatcccttaata
agtttagaagaataccgcttacaaaaaaagaaacttaaagacgacaagagggttgcgcaa
aataacattgaaggtgaattaagagatttaaccatgacgccgccatccaacggtcatggg
gcgcttagtgccagaaattcgagccaaccttctacggcgaataatggaagtaattcattc
aagagctcagccgtcccacagacttcgcctggtcagccgagaaagggccaaaacggttct
aatactatagaagatatcaacaataatcgtaatccaacttcccatgcgaataggaaggta
gtaatagaaagcaacaactcagatgacgaatccatgcaggataccaacggcacaagtaat
cattatcccaaagtttcgcgcaagaaaaatgatatctcctctgcttcatcgtcccgaatg
gaagataacgaacccagcgcaacgaacatcaataatgccgcagatgataccatactaaga
caactattgcccaagaataggagagtaacgtcagggagaaggactacaagcgccgccggt
ggtataagaaaaataagtggctccatcaagaaataa

DBGET integrated database retrieval system