KEGG   Saccharomyces cerevisiae (budding yeast): YFR031CHelp
Entry
YFR031C           CDS       T00005                                 

Gene name
SMC2
Definition
condensin subunit SMC2
Orthology
K06674  
structural maintenance of chromosome 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YFR031C (SMC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VI:complement(216594..220106)
Genome map
AA seq 1170 aa AA seqDB search
MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRAS
SLQDLIYKRGQAGVTKASVTIVFDNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLINGH
RAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSEILSLIEEAAGTKMFEDRREK
AERTMSKKETKLQENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLEKTERIVVSYEYY
NIKHKHTSIRETLENGETRMKMLNEFVKKTSEEIDSLNEDVEEIKLQKEKELHKEGTISK
LENKENGLLNEISRLKTSLSIKVENLNDTTEKSKALESEIASSSAKLIEKKSAYANTEKD
YKMVQEQLSKQRDLYKRKEELVSTLTTGISSTGAADGGYNAQLAKAKTELNEVSLAIKKS
SMKMELLKKELLTIEPKLKEATKDNELNVKHVKQCQETCDKLRARLVEYGFDPSRIKDLK
QREDKLKSHYYQTCKNSEYLKRRVTNLEFNYTKPYPNFEASFVHGVVGQLFQIDNDNIRY
ATALQTCAGGRLFNVVVQDSQTATQLLERGRLRKRVTIIPLDKIYTRPISSQVLDLAKKI
APGKVELAINLIRFDESITKAMEFIFGNSLICEDPETAKKITFHPKIRARSITLQGDVYD
PEGTLSGGSRNTSESLLVDIQKYNQIQKQIETIQADLNHVTEELQTQYATSQKTKTIQSD
LNLSLHKLDLAKRNLDANPSSQIIARNEEILRDIGECENEIKTKQMSLKKCQEEVSTIEK
DMKEYDSDKGSKLNELKKELKLLAKELEEQESESERKYDLFQNLELETEQLSSELDSNKT
LLHNHLKSIESLKLENSDLEGKIRGVEDDLVTVQTELNEEKKRLMDIDDELNELETLIKK
KQDEKKSSELELQKLVHDLNKYKSNTNNMEKIIEDLRQKHEFLEDFDLVRNIVKQNEGID
LDTYRERSKQLNEKFQELRKKVNPNIMNMIENVEKKEAALKTMIKTIEKDKMKIQETISK
LNEYKRETLVKTWEKVTLDFGNIFADLLPNSFAKLVPCEGKDVTQGLEVKVKLGNIWKES
LIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFI
VVSLKEGMFANANRVFRTRFQDGTSVVSIM
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagaggaattgattattgatggtttcaaatcatacgctacaagaacagtcatt
actgattgggaccctcaattcaatgctattacaggtctaaatgggtccggtaagtcgaac
attttggacgccatttgcttcgtgctcggtatagcatcaatgagcactgtgcgagcatct
agcctgcaagatttgatctataagcgtggtcaagcaggtgttaccaaggcaagcgtaacc
attgtttttgataataccgataaatcaaattctcccattgggttcactaactctcctcaa
atctctgttacaaggcaagtcgtgcttggtggaacttctaaatatctgataaatgggcat
agggcacctcaacagtcggttttgcaactatttcaatccgtgcagttaaatatcaataat
cctaattttttaatcatgcaaggtaaaattaccaaggttttgaatatgaaaccctcagag
atcttatcactgattgaagaggcagcagggacaaaaatgttcgaggatcgtagggaaaag
gcagaaagaacaatgtctaagaaagaaactaaattacaggagaacaggactctgttaact
gaagagatcgaacctaaactggaaaaacttcgaaacgaaaagagaatgttcctagaattt
cagtctactcagactgatttggaaaaaactgaacgaattgttgtatcctatgaatactat
aacattaaacataaacatacatcaataagagaaactctggagaacggtgagactcgtatg
aaaatgttaaatgaatttgttaagaaaacttccgaagaaatagacagtttgaatgaggat
gtcgaggaaatcaaacttcagaaagaaaaagaactacacaaagaaggcacaatctccaag
ttggaaaataaggagaacggtcttttaaatgaaatttctcgtttgaaaacttcactgtcg
ataaaagtagaaaatttgaatgatactactgaaaaatcaaaggctctggagtcagaaatt
gcaagttcctctgcaaagctaatcgaaaaaaaatcggcatacgctaacactgaaaaggat
tataaaatggtgcaggaacaactcagtaaacaaagggatctttataaacgaaaagaagaa
ttagtttccactttaaccacaggtatttcctcgaccggtgccgcagacggtggttataac
gcacagttggccaaggcaaagactgagctgaatgaagtctccttggcgataaaaaaatca
agcatgaaaatggagttgttgaagaaagagctattgacaattgaacctaaattaaaggag
gccacgaaagataacgagttaaatgtgaagcatgttaaacaatgccaagaaacgtgcgat
aaactacgagcccgactagtcgaatatgggtttgatccatcacgaattaaagacctgaag
caaagagaggataaattgaagagccattattatcaaacatgtaagaactctgaatattta
aaaagacgcgtaacaaatctggaatttaactatacgaaaccttatcctaattttgaagcc
agctttgtccatggggtggtgggtcaacttttccagatagataatgataatattcgctat
gctactgctttgcaaacttgtgccggaggtaggctattcaatgttgttgttcaagattct
cagacggccactcagctattagaaagaggaagattacgcaagcgtgttaccatcatacct
cttgataagatatatacgaggccaataagttctcaagtgcttgatttagccaagaaaatt
gctcctgggaaagttgaattggcaataaatttaataaggtttgatgaatctatcactaaa
gcgatggaatttatttttggaaatagtttaatctgtgaagatccggaaacagcaaagaaa
attaccttccatccaaagatccgcgctagaagtatcacccttcaaggtgatgtatacgac
ccagagggtacattgtctggtggtagtagaaatacctctgaatcgttattagttgatatt
caaaaatacaatcaaattcaaaaacaaattgagaccattcaggctgatctcaaccatgta
acggaagagctacagacgcaatatgctacatcgcaaaaaacaaagaccattcaaagtgat
ttaaatctctcgttgcataaattggatttggctaagcgtaatctcgacgcgaatccatct
tcccaaataattgctaggaatgaagaaattttgagggacattggagagtgtgagaatgaa
atcaaaaccaagcaaatgagcttaaagaaatgtcaagaagaagtttcgaccattgaaaaa
gacatgaaggagtacgatagcgataaaggatccaagttaaatgaattaaagaaggaattg
aaactattggcgaaagagctggaggagcaggaatcggagtcagaacgtaaatatgacttg
tttcaaaacttggaattagaaacagagcaattgagctcagaactagattctaataagacg
ctattgcataaccatttgaaatctattgaaagtttgaaattggaaaattctgatttggag
ggaaagatacgaggtgttgaagacgaccttgtaacagtccagacagaactgaacgaagaa
aagaaaaggttgatggacattgatgatgaactaaatgaattagaaacattgataaagaaa
aaacaggacgagaaaaaaagcagtgaattagaactacaaaaattggtccatgacttgaac
aaatataagtctaatacgaacaacatggaaaagataattgaagatctgcgacagaaacac
gaatttcttgaggattttgatctggtgagaaatatcgtcaaacaaaatgagggtatcgat
ttggatacttacagagaaaggagtaaacaattgaacgagaagtttcaagagctcagaaaa
aaagttaatccaaatattatgaatatgatagaaaatgttgagaaaaaggaggcagcatta
aaaacaatgattaaaacgattgaaaaagataagatgaaaatccaagagactatatcgaag
ttgaacgaatataaaagagaaactttagtcaaaacatgggagaaagtgacacttgatttt
ggtaatatttttgcagaccttttaccaaattcatttgcaaaattggttccatgcgaaggt
aaggacgtaacgcagggtttagaggttaaagtaaagcttggtaatatatggaaggaaagt
ttgattgaattgtccggtgggcaaaggtcgttgattgctttgtcattgattatggcattg
ttgcaatttcgaccagcgcctatgtatattttggatgaagttgatgctgctcttgattta
agtcatacgcaaaatataggtcatttgattaaaacaaggtttaaaggatctcagttcatt
gtagtctcgcttaaagaaggtatgtttgccaatgctaatagggtcttcaggacgagattt
caagatggtacctccgtagttagtataatgtga

DBGET integrated database retrieval system