KEGG   Saccharomyces cerevisiae (budding yeast): YFR034CHelp
Entry
YFR034C           CDS       T00005                                 

Gene name
PHO4
Definition
Pho4p
Orthology
K06658  
phosphate system positive regulatory protein PHO4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VI:complement(225020..225958)
Genome map
AA seq 312 aa AA seqDB search
MGRTTSEGIHGFVDDLEPKSSILDKVGDFITVNTKRHDGREDFNEQNDELNSQENHNSSE
NGNENENEQDSLALDDLDRAFELVEGMDMDWMMPSHAHHSPATTATIKPRLLYSPLIHTQ
SAVPVTISPNLVATATSTTSANKVTKNKSNSSPYLNKRRGKPGPDSATSLFELPDSVIPT
PKPKPKPKQYPKVILPSNSTRRVSPVTAKTSSSAEGVVVASESPVIAPHGSSHSRSLSKR
RSSGALVDDDKRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAAC
RYIRHLQQNVST
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtacaacttctgagggaatacacggttttgtggacgatctagagcccaagagc
agcattcttgataaagtcggagactttatcaccgtaaacacgaaacggcatgatgggcgc
gaggacttcaacgagcaaaacgacgagctgaacagtcaagagaaccacaacagcagtgag
aatgggaacgagaatgaaaatgaacaagacagtctcgcgttggacgacctagaccgcgcc
tttgagctggtggaaggtatggatatggactggatgatgccctcgcatgcgcaccactcc
ccagctacaactgctacaatcaagccgcggctattatattcgccgctaatacacacgcaa
agtgcggttcccgtaaccatttcgccgaacttggtcgctactgctacttccaccacatcc
gctaacaaagtcactaaaaacaagagtaatagtagtccgtatttgaacaagcgcagaggt
aaacccgggccggattcggccacttcgctgttcgaattgcccgacagcgttatcccaact
ccgaaaccgaaaccgaaaccaaagcaatatccgaaagttattctgccgtcgaacagcaca
agacgcgtatcaccggtcacggccaagaccagcagcagcgcagaaggcgtggtcgtagca
agtgagtctcctgtaatcgcgccgcacggatcgagccattcgcggtcgctgagtaagcga
cggtcatcgggcgcgctcgtggacgatgacaagcgcgaatcacacaagcatgcagagcaa
gcacggcgtaatcgattagcggtcgcgctgcacgaactggcgtctttaatccccgcggag
tggaaacagcaaaatgtgtcggccgcgccgtccaaagcgaccaccgtggaggcggcctgc
cggtacatccgtcacctacagcagaacgtgagcacgtga

DBGET integrated database retrieval system