KEGG   Saccharomyces cerevisiae (budding yeast): YFR036WHelp
Entry
YFR036W           CDS       T00005                                 

Gene name
CDC26, HIT3, SCD26
Definition
anaphase promoting complex subunit CDC26
Orthology
K03359  
anaphase-promoting complex subunit 12
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:sce04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VI:226963..227337
Genome map
AA seq 124 aa AA seqDB search
MIRRAPTTLQLSHDDVTSLIDDLNEQKLKQQLNIEKTKYFQGKNGGSLHSNTDFQDTSQN
IEDNNNDNDNDIDEDDDMSSYNDKAASVAHTRVLNSLHLSTDSNTAHETSNANDNHNPFY
IREE
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgatcagaagggcccctaccaccttgcagctcagtcacgacgacgtaacctctctgatc
gatgacctgaacgagcagaaactcaagcagcagctgaatatcgagaagacaaaatacttc
caaggaaaaaatggcggatcgctgcactccaatacagactttcaggacacatcgcagaat
atcgaagacaacaataacgataacgataacgatatcgatgaagatgacgacatgtcatct
tacaacgacaaagcagcctcggtagcgcacaccagagtcctcaattccttgcatctgtcc
accgacagcaataccgcccacgagacgtccaatgcaaacgacaaccacaaccccttctac
atccgcgaggaataa

DBGET integrated database retrieval system