KEGG   Saccharomyces cerevisiae (budding yeast): YGL026CHelp
Entry
YGL026C           CDS       T00005                                 

Gene name
TRP5
Definition
tryptophan synthase TRP5 (EC:4.2.1.20)
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YGL026C (TRP5)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YGL026C (TRP5)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YGL026C (TRP5)
Enzymes [BR:sce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YGL026C (TRP5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:complement(446412..448535)
Genome map
AA seq 707 aa AA seqDB search
MSEQLRQTFANAKKENRNALVTFMTAGYPTVKDTVPILKGFQDGGVDIIELGMPFSDPIA
DGPTIQLSNTVALQNGVTLPQTLEMVSQARNEGVTVPIILMGYYNPILNYGEERFIQDAA
KAGANGFIIVDLPPEEALKVRNYINDNGLSLIPLVAPSTTDERLELLSHIADSFVYVVSR
MGTTGVQSSVASDLDELISRVRKYTKDTPLAVGFGVSTREHFQSVGSVADGVVIGSKIVT
LCGDAPEGKRYDVAKEYVQGILNGAKHKVLSKDEFFAFQKESLKSANVKKEILDEFDENH
KHPIRFGDFGGQYVPEALHACLRELEKGFDEAVADPTFWEDFKSLYSYIGRPSSLHKAER
LTEHCQGAQIWLKREDLNHTGSHKINNALAQVLLAKRLGKKNVIAETGAGQHGVATATAC
AKFGLTCTVFMGAEDVRRQALNVFRMRILGAKVIAVTNGTKTLRDATSEAFRFWVTNLKT
TYYVVGSAIGPHPYPTLVRTFQSVIGKETKEQFAAMNNGKLPDAVVACVGGGSNSTGMFS
PFEHDTSVKLLGVEAGGDGVDTKFHSATLTAGRPGVFHGVKTYVLQDSDGQVHDTHSVSA
GLDYPGVGPELAYWKSTGRAQFIAATDAQALLGFKLLSQLEGIIPALESSHAVYGACELA
KTMKPDQHLVINISGRGDKDVQSVAEVLPKLGPKIGWDLRFEEDPSA
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacaactcagacaaacatttgctaacgctaaaaaagaaaacaggaacgccttg
gtcacatttatgaccgcaggttacccaacagtcaaagacactgtccctattctcaagggt
ttccaggatggtggtgtagatatcatcgaattgggtatgcccttctctgatccaattgca
gatggtcctacaattcaattatctaatactgtggctttgcaaaacggtgttaccttgcct
caaactctagaaatggtctcccaagctagaaatgaaggtgttaccgtacccataatccta
atgggttactataaccctattctaaactacggtgaagaaagatttattcaggacgctgcc
aaggctggtgctaatggttttatcatcgtcgatttgccaccagaggaggcgttgaaggtc
agaaactacatcaatgataatggtttgagcctgatcccactagtggctccttctaccacc
gacgaaagattggaattactatcgcatattgccgattcgtttgtctacgttgtgtctaga
atgggtactactggtgttcaaagttctgtggccagtgatttggatgaactcatctctaga
gtcagaaagtacaccaaggatactcctttggccgttgggtttggtgtctctaccagagaa
catttccaatcagttggtagtgttgctgacggtgtagtgattggttccaaaatcgtcaca
ttatgtggagatgctccagagggcaaaaggtacgacgttgctaaggaatatgtacaggga
attctaaatggtgctaagcataaggttctgtccaaggacgaattctttgcctttcaaaaa
gagtccttgaagtccgcaaacgttaagaaggaaatactggacgaatttgatgaaaatcac
aagcacccaattagatttggggactttggtggtcagtatgtcccagaagctcttcatgca
tgtctaagagagttggaaaagggttttgatgaagctgtcgccgatcccacattctgggaa
gacttcaaatccttgtattcttatattggccgtccttcttcactacacaaagctgagaga
ttaactgagcattgtcaaggtgctcaaatctggttgaagagagaagatcttaaccacacg
ggatctcacaagatcaacaatgctttagcacaagttcttctagctaaaagattaggcaag
aagaacgttattgctgaaaccggtgctggtcaacacggtgttgccactgccactgcatgt
gctaaatttggcttaacctgtactgtgttcatgggtgcagaagatgttcgtcgccaagct
ttaaacgtcttcagaatgagaattctcggtgctaaagtaattgctgttactaatggtaca
aagactctaagagacgctacttcagaggcattcagattttgggttactaacttgaaaact
acttactacgtcgtcggttctgccattggtcctcacccatatccaactttggttagaact
ttccaaagtgtcattggtaaagaaaccaaggaacagtttgctgccatgaacaatggtaaa
ttacctgacgcagttgttgcatgtgttgggggtggttccaactctacaggtatgttttca
ccattcgagcatgatacttccgttaagttattgggtgtggaagccggtggtgatggtgta
gatacaaagttccactctgctactctaactgccggtagacctggtgtcttccatggtgtc
aagacttatgtcttgcaagatagtgatggtcaagtccatgatactcattctgtttctgct
gggttagactacccaggtgtcggtccagaattggcatattggaaatctactggccgtgct
caattcattgcagctactgacgctcaggctctgcttggctttaaattattatctcaatta
gaaggtattattcccgctttggaatcttctcatgctgtttatggcgcttgcgaattggct
aagacgatgaagcctgatcaacatttggttatcaatatttctggtagaggtgataaagat
gtccaaagtgtcgctgaagtcttgccgaaattaggtccaaagataggttgggatttgaga
ttcgaagaagacccatctgcctaa

DBGET integrated database retrieval system