KEGG   Saccharomyces cerevisiae (budding yeast): YGL030WHelp
Entry
YGL030W           CDS       T00005                                 

Gene name
RPL30
Definition
(RefSeq) ribosomal 60S subunit protein L30
  KO
K02908  
large subunit ribosomal protein L30e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    YGL030W (RPL30)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    YGL030W (RPL30)
  Archaea
    YGL030W (RPL30)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
VII:join(439091..439093,439324..439638)
Genome map
AA seq 105 aa AA seqDB search
MAPVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYA
MLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggccccagttaaatcccaagaatctatcaaccaaaagttggctttggttatcaagtct
ggtaagtacaccttaggttacaagtccactgtcaagtctttgagacaaggtaagtctaag
ttgatcatcattgccgctaacactccagttttgagaaagtccgaattggaatattacgct
atgttgtccaagactaaggtctactacttccaaggtggtaacaacgaattgggtactgct
gtcggtaagttattcagagtcggtgttgtctctattttggaagctggtgactctgatatc
ttgaccaccttggcttaa

DBGET integrated database retrieval system