KEGG   Saccharomyces cerevisiae (budding yeast): YGL037CHelp
Entry
YGL037C           CDS       T00005                                 

Gene name
PNC1
Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YGL037C (PNC1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     YGL037C (PNC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VII:complement(427297..427947)
Genome map
AA seq 216 aa AA seqDB search
MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISF
AKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIV
DKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGY
KTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttaattgttgttgatatgcaaaatgattttatttcacctttaggttccttg
actgttccaaaaggtgaggaattaatcaatcctatctcggatttgatgcaagatgctgat
agagactggcacaggattgtggtcaccagagattggcacccttccagacatatttcgttc
gcaaagaaccataaagataaagaaccctattcaacatacacctaccactctccaaggcca
ggcgatgattccacgcaagagggtattttgtggcccgtacactgtgtgaaaaacacctgg
ggtagtcaattggttgaccaaataatggaccaagtggtcactaagcatattaagattgtc
gacaagggtttcttgactgaccgtgaatactactccgccttccacgacatctggaacttc
cataagaccgacatgaacaagtacttagaaaagcatcatacagacgaggtttacattgtc
ggtgtagctttggagtattgtgtcaaagccaccgccatttccgctgcagaactaggttat
aagaccactgtcctgctggattacacaagacccatcagcgatgatcccgaagtcatcaat
aaggttaaggaagagttgaaggcccacaacatcaatgtcgtggataaataa

DBGET integrated database retrieval system