KEGG   Saccharomyces cerevisiae (budding yeast): YGL040CHelp
Entry
YGL040C           CDS       T00005                                 

Gene name
HEM2, OLE4, SLU1
Definition
porphobilinogen synthase HEM2 (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YGL040C (HEM2)
Enzymes [BR:sce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     YGL040C (HEM2)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YGL040C (HEM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VII:complement(419527..420555)
Genome map
AA seq 342 aa AA seqDB search
MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSL
PNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIR
EYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSD
MIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPA
GRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAA
EKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDEEN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcatacagctgaatttttggaaacagaaccaacagaaatctcatctgttctagcaggt
ggttataatcacccactgctgagacagtggcaaagtgagcgtcaactgactaagaacatg
ttgatttttccgctattcatctccgataatccagatgactttactgaaattgactctcta
cctaatatcaatagaatcggtgtaaataggctaaaagactacttaaagccattagtggcc
aagggtttgcgttctgtgatcttgtttggtgtgcctctcatccctggtaccaaggatcca
gtgggtacagcggctgacgatcctgcagggccagtcattcaaggtattaaattcattcgt
gagtatttccctgaactgtatattatttgcgatgtctgtctctgtgaatacacttctcat
ggccattgcggggttctatacgatgatggtactattaatagagaacgtagtgtctctaga
ttagcagctgtggcagttaactacgctaaagctggtgcgcactgtgtggctcccagtgat
atgatcgatggtaggatcagagatattaaacgaggcttaataaatgcaaacttggctcac
aagaccttcgtgttatcctatgcagctaagtttagcggtaatctatatgggccattccgt
gatgctgcttgttcagctccttcgaatggtgataggaaatgttaccaattacctcctgcc
ggtcgtggcctggcacgtagggcgttggaaagggatatgagtgaaggtgccgacggtatt
attgttaagccttccactttctacttagatataatgagggatgcaagtgaaatttgtaaa
gacttaccaatctgcgcatatcacgtgtcgggcgaatacgcaatgttacatgctgcagct
gaaaaaggtgttgttgatttgaagacaattgcctttgaatctcatcaaggtttcttgagg
gcgggtgccagattaatcatcacttatttggctcctgagttcctagactggttagatgaa
gaaaactaa

DBGET integrated database retrieval system