KEGG   Saccharomyces cerevisiae (budding yeast): YGL055WHelp
Entry
YGL055W           CDS       T00005                                 

Gene name
OLE1, MDM2
Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:sce01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sce01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:398628..400160
Genome map
AA seq 510 aa AA seqDB search
MPTSGTTIELIDDQFPKDDSASSGIVDEVDLTEANILATGLNKKAPRIVNGFGSLMGSKE
MVSVEFDKKGNEKKSNLDRLLEKDNQEKEEAKTKIHISEQPWTLNNWHQHLNWLNMVLVC
GMPMIGWYFALSGKVPLHLNVFLFSVFYYAVGGVSITAGYHRLWSHRSYSAHWPLRLFYA
IFGCASVEGSAKWWGHSHRIHHRYTDTLRDPYDARRGLWYSHMGWMLLKPNPKYKARADI
TDMTDDWTIRFQHRHYILLMLLTAFVIPTLICGYFFNDYMGGLIYAGFIRVFVIQQATFC
INSLAHYIGTQPFDDRRTPRDNWITAIVTFGEGYHNFHHEFPTDYRNAIKWYQYDPTKVI
IYLTSLVGLAYDLKKFSQNAIEEALIQQEQKKINKKKAKINWGPVLTDLPMWDKQTFLAK
SKENKGLVIISGIVHDVSGYISEHPGGETLIKTALGKDATKAFSGGVYRHSNAAQNVLAD
MRVAVIKESKNSAIRMASKRGEIYETGKFF
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgccaacttctggaactactattgaattgattgacgaccaatttccaaaggatgactct
gccagcagtggcattgtcgacgaagtcgacttaacggaagctaatattttggctactggt
ttgaataagaaagcaccaagaattgtcaacggttttggttctttaatgggctccaaggaa
atggtttccgtggaattcgacaagaagggaaacgaaaagaagtccaatttggatcgtctg
ctagaaaaggacaaccaagaaaaagaagaagctaaaactaaaattcacatctccgaacaa
ccatggactttgaataactggcaccaacatttgaactggttgaacatggttcttgtttgt
ggtatgccaatgattggttggtactttgctctctctggtaaagtgcctttgcatttaaac
gttttccttttctccgttttctactacgctgtcggtggtgtttctattactgccggttac
catagattatggtctcacagatcttactccgctcactggccattgagattattctacgct
atcttcggttgtgcttccgttgaagggtccgctaaatggtggggccactctcacagaatt
caccatcgttacactgataccttgagagatccttatgacgctcgtagaggtctatggtac
tcccacatgggatggatgcttttgaagccaaatccaaaatacaaggctagagctgatatt
accgatatgactgatgattggaccattagattccaacacagacactacatcttgttgatg
ttgttaaccgctttcgtcattccaactcttatctgtggttactttttcaacgactatatg
ggtggtttgatctatgccggttttattcgtgtctttgtcattcaacaagctaccttttgc
attaactccttggctcattacatcggtacccaaccattcgatgacagaagaacccctcgt
gacaactggattactgccattgttactttcggtgaaggttaccataacttccaccacgaa
ttcccaactgattacagaaacgctattaagtggtaccaatacgacccaactaaggttatc
atctatttgacttctttagttggtctagcatacgacttgaagaaattctctcaaaatgct
attgaagaagccttgattcaacaagaacaaaagaagatcaataaaaagaaggctaagatt
aactggggtccagttttgactgatttgccaatgtgggacaaacaaaccttcttggctaag
tctaaggaaaacaagggtttggttatcatttctggtattgttcacgacgtatctggttat
atctctgaacatccaggtggtgaaactttaattaaaactgcattaggtaaggacgctacc
aaggctttcagtggtggtgtctaccgtcactcaaatgccgctcaaaatgtcttggctgat
atgagagtggctgttatcaaggaaagtaagaactctgctattagaatggctagtaagaga
ggtgaaatctacgaaactggtaagttcttttaa

DBGET integrated database retrieval system