KEGG   Saccharomyces cerevisiae (budding yeast): YGL086WHelp
Entry
YGL086W           CDS       T00005                                 

Gene name
MAD1
Definition
Mad1p
Orthology
K06679  
mitotic spindle assembly checkpoint protein MAD1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YGL086W (MAD1)
   04113 Meiosis - yeast
    YGL086W (MAD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:347119..349368
Genome map
AA seq 749 aa AA seqDB search
MDVRAALQCFFSALSGRFTGKKLGLEIYSIQYKMSNSGGSSPFLESPGGSPDVGSTNGQS
NRQIQALQFKLNTLQNEYEIEKLQLQKQTNILEKKYKATIDELEKALNDTKYLYESNDKL
EQELKSLKERSANSMNDKDKCIEELRTTLQNKDLEMETLRQQYDSKLSKVTNQCDHFKLE
AESSHSLLMKYEKEIKRQSVDIKDLQHQVMEKDDELSSVKASKMINSHPNYSTEEFNELT
EMNKMIQDQVQYTKELELANMQQANELKKLKQSQDTSTFWKLENEKLQNKLSQLHVLESQ
YENLQLENIDLKSKLTKWEIYNDSDDDDDNNVNNNDNNNNNKNDNNNDNNNDTSNNNNIN
NNNRTKNNIRNNPEEIIRDWKLTKKECLILTDMNDKLRLDNNNLKLLNDEMALERNQILD
LNKNYENNIVNLKRLNHELEQQKSLSFEECRLLREQLDGLYSAQNNALLEVENSETHASN
KNVNEDMNNLIDTYKNKTEDLTNELKKLNDQLLSNSNDVETQRKKRKLTSDQIGLNYSQR
LNELQLENVSVSRELSKAQTTIQLLQEKLEKLTKLKEKKIRILQLRDGPFIKDQFIKKNK
LLLLEKENADLLNELKKNNPAVETVPISVYDSLNFELKQFEQEVFKSNKRFSRLKQVFNN
KSLEFIDVVNSLLGFKLEFQQDSRVKIFSCFKPEKYLIADLNENTLKSNLDADIEGWDDL
MNLWVEDRGQLPCFLATITLRLWEQRQAK
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgagagcggcattgcaatgtttcttcagtgcattgagtggacgattcactgga
aaaaaattgggactagagatctattctatccagtacaaaatgagcaatagtggtgggtcc
tctcctttcttggaaagccctggaggttcgcccgacgtaggcagtacaaatggacaaagt
aatcgtcagattcaggcgttacaattcaagctcaatactctacaaaatgagtatgagatt
gaaaaattgcagctacaaaaacagacgaatatcttagaaaagaaatataaggccacgatt
gacgaattagagaaagcattgaatgatacaaaatatctttatgaaagcaatgataaattg
gagcaagagttaaagagtttgaaagaaagatcagctaattcgatgaatgataaagacaaa
tgcatagaggaattgcgaacaaccctccaaaacaaagatttagaaatggagactttaagg
cagcagtatgattcgaagttatcaaaggtcactaaccaatgtgaccatttcaagttggaa
gcagagagctctcattcgctactgatgaaatatgagaaagaaataaagaggcaaagtgtg
gatatcaaagatttgcagcatcaagtgatggaaaaggatgatgaattatcttcggtaaaa
gcatctaagatgataaactcacatccaaactactccaccgaagagttcaacgagctcact
gaaatgaacaaaatgatccaagaccaagttcagtatactaaagaattggaactagcgaac
atgcaacaagccaatgaattgaaaaaacttaaacaatcccaggacacttctactttttgg
aaattagaaaatgaaaaactacaaaacaaattaagtcaattacacgtactcgaaagtcaa
tatgaaaatcttcaattggaaaacatagatctaaaatcgaaattaaccaaatgggaaatt
tataatgatagtgacgatgatgatgataacaatgttaacaacaatgataataataataat
aataaaaatgataataataatgataataataatgatacaagtaataacaacaatattaat
aataacaacagaaccaaaaataacataagaaataaccctgaagagattatccgggactgg
aaacttaccaaaaaggaatgtttaattttgacagatatgaatgataagttaagattggac
aataacaatttaaagctactgaatgatgaaatggctttagagagaaaccaaatactagat
ttgaacaagaattatgaaaacaacatagtaaatttgaaaagattaaatcacgagttagaa
caacagaagagtttatctttcgaagaatgtcgattactgcgcgaacaattagatggccta
tattccgcacaaaataatgctttactagaggtcgaaaatagtgaaacacatgcgtcaaac
aagaacgtaaacgaagatatgaataatttgatcgatacttataaaaataagacagaagat
ttaacaaacgaactaaagaagctaaacgatcagttattatcaaattccaatgatgtagaa
acacaaagaaaaaagaggaagttgacaagtgaccaaattggtttaaattattcacagagg
ctcaacgaattgcaactggaaaatgtaagtgtctcgagggagttgagtaaagcacaaact
acaattcagctactacaagaaaaattagaaaagttaactaaactaaaggagaaaaaaata
cgtatactgcaattacgtgacggccccttcataaaagatcaatttatcaagaaaaacaaa
ttacttcttctagaaaaggaaaatgcagatttacttaacgaattgaaaaagaataatcca
gcagtggaaacagtacccatttctgtttatgattcactaaatttcgagttgaaacagttc
gaacaggaagtttttaagtcaaataaaagattttccagactaaagcaagttttcaataat
aaatctttggagtttattgacgttgtaaactcattattaggttttaaattggaatttcaa
caagatagtcgtgtgaaaatattttcctgtttcaaacctgaaaaatatttgattgctgat
ctaaatgaaaacactttgaaatctaaccttgatgcagatatagaaggatgggatgatctc
atgaatctatgggtggaagatagaggtcaacttccgtgctttttggcaacaataacattg
cgtctgtgggaacagcgacaagccaaataa

DBGET integrated database retrieval system