KEGG   Saccharomyces cerevisiae (budding yeast): YGL114WHelp
Entry
YGL114W           CDS       T00005                                 

Definition
hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:293460..295637
Genome map
AA seq 725 aa AA seqDB search
MPQSTPSQEVQRVPWDNKPALKQITLRATIAGIAIGSLVLTSNFQFGLQTGWVSMMSLPS
ALLACAFFKNIWPLIFPNDRPFSDVENVYVQSMAVAVGTGPLAFGFVGVIPAIEKFLTND
ESGGLREQGQSFTFRELLIWSTALAFFGIFFAVPLRKQVIVREKLPFPSGSATATLISVL
NGTEILQEVSKSELLEMRQRRLNECPEVLQPNRDPEEADYLMNSSHSELGDYTATSQDGS
SILSTGSENYRANIIILLKTFVVSSLYTMVSYFVPVIRSIPVFGKYLSNNYLWNFQPSPA
YIGQGIIMGLPTVSYMLIGCFLGWGVLAPLARYKRWVPPDADVHDWEEGVQGWILWSSLS
IMVADSVVAFIVVTVKSIVKFILIDDKAALLNNIIDDTFQSMLLEEERAINSSRRNTYVD
GRQDTVRLVSRDNEIEVDSKHLVRYTTVISGCLVSSIICIVSIIYLFGIQVIPLYAIITA
LILALFLSILGIRALGETDLNPVSGIGKISQLIFAFIIPRDRPGSVLMNVVSGGIAEASA
QQAGDLMQDLKTGHLLGASPRAQFCAQLIGACWSIILSSFMYLCYNKVYSIPSEQFRIPT
AVVWIDCARLVTGKGLPDKALECSMILGVIFAVLSLIRNTYRDYGYGWILYIPSGVAVGV
GIFNSPSFTIARFIGGWASHFWLKNHRGDLNAKTKMIVFSSGLVLGEGIFSVINMLFICL
NVPHY
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaatctactccaagtcaagaagtacagcgtgtaccatgggataataaacctgct
ttgaagcagataacactccgagcaaccatagcaggtatcgctatagggtctctggtgcta
acatcaaattttcaatttggcctgcaaaccggttgggtttccatgatgtccctgccatcg
gcattgttagcttgtgctttctttaaaaatatctggccattaatatttccgaacgacagg
cctttcagtgacgttgaaaatgtatacgtacaaagtatggcagtagctgtcggaacaggc
ccattagcctttgggtttgtcggcgtcatacctgccatcgagaagttccttactaacgac
gaaagtggtggattaagggaacaaggacagtccttcacttttagagaattgttaatatgg
tccacagccctagcattcttcggtattttttttgcagttcctctaagaaagcaagtaatt
gttagagagaaacttcccttccccagtggtagcgccacggccactttaatttcagtgcta
aatggaactgagattttacaagaggtttctaagtcagagttattggaaatgaggcagagg
agattgaatgaatgccctgaagtgctacaacccaacagagatccagaggaggcggattat
ttaatgaactcttctcatagcgaacttggtgattatacggcaactagccaagatggaagt
tctatcctttctactggctctgagaactacagagcgaatattattattttattgaaaact
tttgttgtttcttcgctttacaccatggtgtcatattttgtaccggtaatacggtctatt
ccagtcttcggaaaatacctctcgaacaattatctctggaattttcagccgtcgcctgcg
tatataggccaagggataataatgggtcttccaacagtatcgtatatgcttatcgggtgc
ttcttaggctggggtgtgttagcaccattggcgagatacaaaagatgggtaccaccagat
gctgatgtccacgactgggaggagggagtgcaaggatggattctttggtcgtcgctttca
ataatggttgctgacagtgtagtcgcttttattgttgtgacagtgaagtccattgtgaaa
tttattcttatagatgacaaagctgctttactgaacaacataatcgatgatacatttcaa
tctatgttactggaggaggaacgcgccattaatagcagcagaagaaatacatatgttgat
ggaaggcaggacaccgtaagattagtgagtagagataacgaaatagaagtagattcgaag
catttggttcgctataccaccgttatcagtggatgtctagtctcctcgataatatgcatt
gtttccataatatatttgtttgggatacaagtaattcccctatatgctattatcactgct
ttgatacttgcgttgtttctatctattctcggtattcgagcacttggagagaccgatctg
aatcctgtgagcggcattggtaagatctctcaattgatttttgcctttatcataccaagg
gatagacctggatcagtgttaatgaacgtggtatcgggaggtattgcagaagcctctgcc
caacaggcgggcgatttaatgcaggatttgaaaacggggcacctcctcggcgcctcccca
agagctcagttctgtgcccaattgataggggcctgttggtcaattattttgtctagcttc
atgtatttgtgctacaataaagtttattcaattccgagtgagcaattcaggataccgaca
gcagtagtgtggatagattgtgcaagactagtaactggtaaagggctccctgataaggcc
ttggagtgctccatgattctcggagtcatatttgccgttttatcattaatcagaaacact
tatagagattacggatacgggtggatattatatattccgtctggtgtagcagtcggtgtt
ggtatatttaattctcccagttttacaattgcaagattcatcggcgggtgggcttcgcat
ttttggttgaagaatcataggggtgacttaaatgcgaaaacaaaaatgattgtattcagt
tcggggttggtcttaggtgaaggtatctttagcgtaataaacatgctcttcatctgctta
aatgtccctcactattag

DBGET integrated database retrieval system