KEGG   Saccharomyces cerevisiae (budding yeast): YGL116WHelp
Entry
YGL116W           CDS       T00005                                 

Gene name
CDC20, PAC5
Definition
Cdc20p
Orthology
K03363  
cell division cycle 20, cofactor of APC complex
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YGL116W (CDC20)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YGL116W (CDC20)
   04113 Meiosis - yeast
    YGL116W (CDC20)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    target recognizing subunit
     YGL116W (CDC20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:289809..291641
Genome map
AA seq 610 aa AA seqDB search
MPESSRDKGNAAISGNRSVLSIASPTKLNILSSDWSRNQGKVSKNSLKRSSSLNIRNSKR
PSLQASANSIYSRPKITIGAPPLIRRDSSFFKDEFDAKKDKATFSAYSSRSYPTIGSESV
VSQTSLSQPTTSREVDEQFTVAADRYIPILQGASQNKVDPETLHEALPPPNASPISHLRA
QTKIVFKQNVAEACGLDMNKRILQYMPEPPKCSSLRQKSYIMKKRTHYSYQQEQKIPDLI
KLRKINTNPERILDAPGFQDDFYLNLLSWSKKNVLAIALDTALYLWNATTGDVSLLTDFE
NTTICSVTWSDDDCHISIGKEDGNTEIWDVETMSLIRTMRSGLGVRIGSLSWLDTLIATG
SRSGEIQINDVRIKQHIVSTWAEHTGEVCGLSYKSDGLQLASGGNDNTVMIWDTRTSLPQ
FSKKTHTAAVKALSWCPYSPNILASGGGQTDKHIHFWNSITGARVGSINTGSQVSSLHWG
QSHTSTNGGMMNKEIVATGGNPENAISVYNYETKFKVAEVVHAHEARICCSQLSPDGTTL
ATVGGDENLKFYKIFDPRCTGRSREDGLMDGMLGLIGKEGCRTNDKENRSKNSSEIHTRR
PSSTSQYLIR
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaagctctagagataagggaaatgcagcaattagcggtaaccgttctgtactt
tctattgcgtccccaacaaagctaaacatactatcttccgattggtccagaaaccaaggt
aaagtttctaaaaattcgctaaagagatcaagttcactgaacattagaaactccaaacgt
cccagtttacaagcctctgccaattctatttattcaagacctaagattacaattggggca
ccaccgttaataagacgagattcttcatttttcaaagatgaatttgacgctaaaaaagac
aaagcaacgttttcggcatactcttctcgttcatatccaacaattggatctgagagcgta
gtttcccaaacatctttatcgcaaccgacaacatctagagaagttgatgagcaatttaca
gtagctgcggatagatatattccaattctacagggagcttcgcaaaacaaggtcgatcct
gaaaccttacacgaggcattacctccgccaaacgcgtcgccaatttcacacttaagggcc
cagactaagattgtcttcaaacaaaatgtagctgaagcgtgtgggttagatatgaataaa
agaatactacaatacatgccggaaccaccaaaatgctcttccttgagacaaaaaagctat
atcatgaagaaaagaacacattatagttatcagcaggaacaaaaaattcctgatttaatt
aaattaaggaaaatcaataccaatccggaaagaattcttgatgcacctggtttccaagac
gacttttatttaaacttgttaagttggtccaaaaaaaatgtcttagctatagcactagac
actgcattatatctgtggaatgccaccactggggatgtttccctgttaacggatttcgaa
aacaccacaatatgcagcgttacgtggtctgatgatgattgtcatatctctatcggtaaa
gaggatgggaacaccgaaatttgggacgttgagaccatgtcattaattagaactatgaga
tcaggcttaggtgtccgtatcggttcattgtcttggttagatactttgatagctacaggc
agtcgtagtggagaaattcaaatcaatgatgtcaggatcaaacagcatattgtatctaca
tgggcagagcacacaggcgaagtctgcggtttgagctataaaagtgacggattgcaactt
gcatctggtggtaatgataacactgtaatgatttgggataccagaacgtccttgcctcaa
ttttccaagaagacgcatactgctgctgtaaaagcactaagctggtgtccatattcgcca
aatattctagcctctggaggcggacaaacagataaacacatccatttttggaacagtatc
acaggtgcacgagttggctcaatcaataccggatcccaggtgagctctttacattggggc
caaagtcatacgtcaaccaatggtggtatgatgaataaagagattgttgccacaggaggt
aatccagagaatgcaatctctgtttataattatgaaacaaaattcaaagttgcagaagta
gttcatgctcatgaagcaagaatatgctgttctcaattgtcccctgacggaaccacattg
gccacagtgggaggagatgaaaacttaaaattttataagatatttgatccaagatgtaca
ggaagatcgagagaagacggattgatggatggtatgctaggacttattggcaaggaaggt
tgtcgaacaaatgataaggagaatcgttccaaaaattcgagtgagattcatacaaggagg
ccctctagtaccagccaatatttgatcaggtga

DBGET integrated database retrieval system