KEGG   Saccharomyces cerevisiae (budding yeast): YGL116WHelp
Entry
YGL116W           CDS       T00005                                 

Gene name
CDC20, PAC5
Definition
(RefSeq) Cdc20p
  KO
K03363  
cell division cycle 20, cofactor of APC complex
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YGL116W (CDC20)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YGL116W (CDC20)
   04113 Meiosis - yeast
    YGL116W (CDC20)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    target recognizing subunit
     YGL116W (CDC20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:289809..291641
Genome map
AA seq 610 aa AA seqDB search
MPESSRDKGNAAISGNRSVLSIASPTKLNILSSDWSRNQGKVSKNSLKRSSSLNIRNSKR
PSLQASANSIYSRPKITIGAPPLIRRDSSFFKDEFDAKKDKATFSAYSSRSYPTIGSESV
VSQTSLSQPTTSREVDEQFTVAADRYIPILQGASQNKVDPETLHEALPPPNASPISHLRA
QTKIVFKQNVAEACGLDMNKRILQYMPEPPKCSSLRQKSYIMKKRTHYSYQQEQKIPDLI
KLRKINTNPERILDAPGFQDDFYLNLLSWSKKNVLAIALDTALYLWNATTGDVSLLTDFE
NTTICSVTWSDDDCHISIGKEDGNTEIWDVETMSLIRTMRSGLGVRIGSLSWLDTLIATG
SRSGEIQINDVRIKQHIVSTWAEHTGEVCGLSYKSDGLQLASGGNDNTVMIWDTRTSLPQ
FSKKTHTAAVKALSWCPYSPNILASGGGQTDKHIHFWNSITGARVGSINTGSQVSSLHWG
QSHTSTNGGMMNKEIVATGGNPENAISVYNYETKFKVAEVVHAHEARICCSQLSPDGTTL
ATVGGDENLKFYKIFDPRCTGRSREDGLMDGMLGLIGKEGCRTNDKENRSKNSSEIHTRR
PSSTSQYLIR
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaagctctagagataagggaaatgcagcaattagcggtaaccgttctgtactt
tctattgcgtccccaacaaagctaaacatactatcttccgattggtccagaaaccaaggt
aaagtttctaaaaattcgctaaagagatcaagttcactgaacattagaaactccaaacgt
cccagtttacaagcctctgccaattctatttattcaagacctaagattacaattggggca
ccaccgttaataagacgagattcttcatttttcaaagatgaatttgacgctaaaaaagac
aaagcaacgttttcggcatactcttctcgttcatatccaacaattggatctgagagcgta
gtttcccaaacatctttatcgcaaccgacaacatctagagaagttgatgagcaatttaca
gtagctgcggatagatatattccaattctacagggagcttcgcaaaacaaggtcgatcct
gaaaccttacacgaggcattacctccgccaaacgcgtcgccaatttcacacttaagggcc
cagactaagattgtcttcaaacaaaatgtagctgaagcgtgtgggttagatatgaataaa
agaatactacaatacatgccggaaccaccaaaatgctcttccttgagacaaaaaagctat
atcatgaagaaaagaacacattatagttatcagcaggaacaaaaaattcctgatttaatt
aaattaaggaaaatcaataccaatccggaaagaattcttgatgcacctggtttccaagac
gacttttatttaaacttgttaagttggtccaaaaaaaatgtcttagctatagcactagac
actgcattatatctgtggaatgccaccactggggatgtttccctgttaacggatttcgaa
aacaccacaatatgcagcgttacgtggtctgatgatgattgtcatatctctatcggtaaa
gaggatgggaacaccgaaatttgggacgttgagaccatgtcattaattagaactatgaga
tcaggcttaggtgtccgtatcggttcattgtcttggttagatactttgatagctacaggc
agtcgtagtggagaaattcaaatcaatgatgtcaggatcaaacagcatattgtatctaca
tgggcagagcacacaggcgaagtctgcggtttgagctataaaagtgacggattgcaactt
gcatctggtggtaatgataacactgtaatgatttgggataccagaacgtccttgcctcaa
ttttccaagaagacgcatactgctgctgtaaaagcactaagctggtgtccatattcgcca
aatattctagcctctggaggcggacaaacagataaacacatccatttttggaacagtatc
acaggtgcacgagttggctcaatcaataccggatcccaggtgagctctttacattggggc
caaagtcatacgtcaaccaatggtggtatgatgaataaagagattgttgccacaggaggt
aatccagagaatgcaatctctgtttataattatgaaacaaaattcaaagttgcagaagta
gttcatgctcatgaagcaagaatatgctgttctcaattgtcccctgacggaaccacattg
gccacagtgggaggagatgaaaacttaaaattttataagatatttgatccaagatgtaca
ggaagatcgagagaagacggattgatggatggtatgctaggacttattggcaaggaaggt
tgtcgaacaaatgataaggagaatcgttccaaaaattcgagtgagattcatacaaggagg
ccctctagtaccagccaatatttgatcaggtga

DBGET integrated database retrieval system