KEGG   Saccharomyces cerevisiae (budding yeast): YGL190CHelp
Entry
YGL190C           CDS       T00005                                 

Gene name
CDC55, TMR4
Definition
protein phosphatase 2A regulatory subunit CDC55
Orthology
K04354  
serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
mRNA surveillance pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    YGL190C (CDC55)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YGL190C (CDC55)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     YGL190C (CDC55)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:complement(145809..147389)
Genome map
AA seq 526 aa AA seqDB search
MAQNNFDFKFSQCFGDKADIVVTEADLITAVEFDYTGNYLATGDKGGRVVLFERSNSRHC
EYKFLTEFQSHDAEFDYLKSLEIEEKINEIKWLRPTQRSHFLLSTNDKTIKLWKVYEKNI
KLVSQNNLTEGVTFAKKGKPDNHNSRGGSVRAVLSLQSLKLPQLSQHDKIIAATPKRIYS
NAHTYHINSISLNSDQETFLSADDLRINLWNLDIPDQSFNIVDIKPTNMEELTEVITSAE
FHPQECNLFMYSSSKGTIKLCDMRQNSLCDNKTKTFEEYLDPINHNFFTEITSSISDIKF
SPNGRYIASRDYLTVKIWDVNMDNKPLKTINIHEQLKERLSDTYENDAIFDKFEVNFSGD
SSSVMTGSYNNNFMIYPNVVTSGDNDNGIVKTFDEHNAPNSNSNKNIHNSIQNKDSSSSG
NSHKRRSNGRNTGMVGSSNSSRSSIAGGEGANSEDSGTEMNEIVLQADKTAFRNKRYGSL
AQRSARNKDWGDDIDFKKNILHFSWHPRENSIAVAATNNLFIFSAL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaacaattttgattttaaattcagccaatgttttggtgataaagcagatatt
gtggtgacagaggcggatctaattacagctgtagaatttgactatactggaaattatctg
gccactggtgataaaggtggccgtgtggtactttttgaaagaagtaatagtagacattgc
gaatataagtttttaacagagtttcaaagtcatgacgcagaatttgattatttaaaatcc
ttagaaattgaagagaagataaatgaaatcaaatggttacgaccaactcaaagatcacac
tttcttttgagcacaaatgataaaactataaaactttggaaagtttatgagaaaaatata
aaattggtaagccagaacaacttaacagaaggggttacgtttgcgaaaaaaggcaagccc
gataaccataacagtagaggaggctccgtgagggctgtattatctttacaatcgctgaaa
ctgcctcaattatcacagcatgacaaaatcattgctgccaccccaaagcgtatatatagt
aatgcacatacctatcacattaattcgatatcgttgaattctgatcaggaaacattttta
agtgctgacgacttgagaatcaatttatggaatctggacataccagatcagagcttcaac
atcgtagatatcaagccaaccaatatggaagaacttaccgaagtgatcacaagcgctgaa
tttcatccgcaagaatgtaatttattcatgtactcttcttccaaaggtacaataaagttg
tgtgatatgagacaaaattccctatgtgacaataaaaccaaaacatttgaagaatatttg
gatccaatcaatcataatttttttacagaaatcacgtcgtcaatttccgacataaaattt
agtccaaatggtaggtatattgcatccagagattatttaactgtcaaaatttgggacgta
aatatggataataagcctttgaaaaccataaacatacatgagcaattgaaggaaagattg
agtgatacctatgaaaacgatgcgattttcgataaatttgaagttaattttagtggtgat
agttcaagtgtaatgactggttcttacaataacaatttcatgatctatcctaatgtagta
acttctggtgataatgataatggcatagtcaaaacttttgatgaacacaacgcacctaat
agcaacagcaataaaaatatccacaacagcatacaaaataaagattctagtagtagtggc
aacagccacaagcgtaggagtaacggacgcaacacaggcatggtgggaagtagtaatagc
tctagaagcagtatagcgggaggagaaggagcaaattcggaggactcgggaaccgaaatg
aatgaaatcgtgttacaagctgacaaaacagcgttcaggaacaaaagatacggttcgcta
gcgcaaaggtctgcaagaaataaggattggggtgacgatattgatttcaagaagaatatt
ttacatttctcatggcatccaagagaaaatagtattgctgttgcagcaactaataattta
ttcattttttccgcattataa

DBGET integrated database retrieval system