KEGG   Saccharomyces cerevisiae (budding yeast): YGL194CHelp
Entry
YGL194C           CDS       T00005                                 

Gene name
HOS2, RTL1
Definition
histone deacetylase HOS2 (EC:3.5.1.98)
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     YGL194C (HOS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:complement(140368..141726)
Genome map
AA seq 452 aa AA seqDB search
MSGTFSYDVKTKENEPLFEFNSAYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVS
SYGLHKIMDLYETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPI
FQNLYDYTTLYTGASLDATRKLINNQSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILN
LLRYHPRILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYNGEFFPGTGDLTEIGCDKGKH
FALNVPLEDGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH
GECVKFVKSFGLPMLVVGGGGYTPRNVSRLWTYETGILNDVLLPEDIPEDIPFRDSFGPD
YSLYPMLDDLYENKNSKKLLEDIRIRCLENIRYLQGAPSVRMDAECIPTQDISALTEEED
KIIQEMNEETEADSSNRLEEMEKENSGLIAFS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaacatttagttatgatgtgaaaacaaaggagaacgaaccattatttgagttt
aattctgcttattctcccagggtatcgtatcattttaactccaaagtttcacattaccat
tatggtgttaagcatccaatgaagccgtttcggttaatgctaacggatcacctagtttcc
tcttatggattgcacaagattatggacctttatgaaacaagaagcgctaccagagacgaa
ttactacaatttcactcggaagactacgtgaattttctctcgaaggtttcaccagaaaat
gcaaacaaactgcccagaggcacacttgaaaattttaacattggagacgactgtcctatt
tttcaaaatttatatgattatacaacactatacactggtgcgagccttgacgccaccagg
aaactaatcaacaatcaatcggacatagcgataaattggtctggtggtcttcatcatgca
aaaaagaatagtccatctgggttttgctatgtaaatgatattgtgctttctattttgaac
ttattacgatatcacccaagaatcctttatatcgatatcgacttacatcacggcgatggt
gtccaggaggcattttacaccacagatagggtcttcacgttgtcttttcataaatataat
ggcgaatttttcccaggaactggtgatctgacagaaattggttgcgacaaaggaaaacat
ttcgcattaaatgtacccctagaagatggcatagatgacgactcatatataaaccttttc
aagtcaattgtagatcctctaataatgactttcaaaccaacacttattgtccaacaatgc
ggtgcggattccttaggtcatgatcgcttaggatgcttcaatttaaatataaaggcacat
ggagaatgcgtaaaatttgtcaaatcatttggtctaccaatgctagtagtgggcggtgga
ggttatacacctagaaatgtatcacggctttggacctacgagacaggaattttaaatgat
gtcttgctaccagaagacatccccgaagatatcccattccgggactcattcgggccggat
tattcactttatcctatgttagatgacttatacgaaaacaaaaacagtaaaaaactactg
gaagacattagaatacgatgtctagaaaatatcagatacttgcaaggagcaccaagtgtc
agaatggatgctgaatgcataccgacacaagatataagtgccctgacagaagaagaggat
aaaatcattcaagaaatgaatgaagaaacagaagcagacagttcaaataggctagaagaa
atggaaaaagaaaacagtggattgattgccttttcatag

DBGET integrated database retrieval system