KEGG   Saccharomyces cerevisiae (budding yeast): YGL201CHelp
Entry
YGL201C           CDS       T00005                                 

Gene name
MCM6
Definition
Mcm6p (EC:3.6.4.12)
Orthology
K02542  
DNA replication licensing factor MCM6 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
DNA replication
Cell cycle - yeast
Meiosis - yeast
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YGL201C (MCM6)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YGL201C (MCM6)
   04113 Meiosis - yeast
    YGL201C (MCM6)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YGL201C (MCM6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:complement(117854..120907)
Genome map
AA seq 1017 aa AA seqDB search
MSSPFPADTPSSNRPSNSSPPPSSIGAGFGSSSGLDSQIGSRLHFPSSSQPHVSNSQTGP
FVNDSTQFSSQRLQTDGSATNDMEGNEPARSFKSRALNHVKKVDDVTGEKVREAFEQFLE
DFSVQSTDTGEVEKVYRAQIEFMKIYDLNTIYIDYQHLSMRENGALAMAISEQYYRFLPF
LQKGLRRVVRKYAPELLNTSDSLKRSEGDEGQADEDEQQDDDMNGSSLPRDSGSSAAPGN
GTSAMATRSITTSTSPEQTERVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEV
RPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVR
IQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSST
LDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRET
ELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGH
EAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSG
KASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQT
ISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCN
EKIDTELASHIVDLHMKRDEAIEPPFSAEQLRRYIKYARTFKPILTKEARSYLVEKYKEL
RKDDAQGFSRSSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDV
DDVEMDEEFDNIESQSHAASGNNDDNDDGTGSGVITSEPPADIEEGQSEATARPGTSEKK
KTTVTYDKYVSMMNMIVRKIAEVDREGAEELTAVDIVDWYLLQKENDLGSLAEYWEERRL
AFKVIKRLVKDRILMEIHGTRHNLRDLENEENENNKTVYVIHPNCEVLDQLEPQDSS
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccccttttccagctgacacaccaagcagtaatagaccttccaactcctctccg
ccaccatcgtcgataggtgctggcttcggaagcagtagcggactcgattcgcaaataggc
tctaggttacatttcccaagttcttctcaaccgcatgtcagtaattcacaaacaggccct
tttgttaacgattccactcagtttagttctcaaaggttgcaaaccgatggttccgcgact
aatgatatggagggaaatgaacctgccagaagcttcaaaagtagagctttgaatcacgtt
aagaaagttgatgacgttactggtgaaaaagtccgtgaagcgttcgagcagtttttggaa
gacttttccgttcaatccactgatactggtgaagttgaaaaagtttatagagctcaaatt
gaatttatgaaaatatatgacctaaacaccatttatatagattatcagcatttatccatg
agagaaaatggtgctctagctatggctatctcagaacaatattacagatttttgcctttt
ttacaaaagggtttaagaagagtagtaagaaagtatgcacctgaattgttaaacacaagt
gactcattgaagagatccgaaggtgacgaaggtcaagcggatgaagatgagcaacaggac
gatgatatgaatgggtcgagtctaccaagagattctggatcatcagccgcaccagggaat
gggacatctgccatggcaacgaggtcaataacaacttctacgtcacctgaacagacggaa
cgtgtttttcaaatcagtttcttcaatctaccaacagttcacagaattcgtgatataaga
tctgaaaagattggttcactattgagtatatcagggacagtgacaagaacatctgaggtc
cgtccagaattatacaaggcaagctttacgtgtgatatgtgccgtgctatcgtagataac
gtagaacagtccttcaagtacactgaaccgacattttgcccgaacccatcatgcgaaaat
agagccttttggacattaaatgttacaagatccaggtttcttgattggcaaaaagtcaga
attcaagaaaatgctaacgaaatacctacaggctccatgccgcgtacgctggacgtcatt
cttcgaggtgatagtgtcgaaagagccaagccaggtgaccgttgcaaatttacgggtgtg
gaaattgtagtacctgatgttacacaattggggctaccaggtgtgaagccaagttcaaca
ttagatactagaggtatttcgaagactactgaaggtttgaatagtggtgttactggttta
cgctctcttggtgttcgtgatttgacatacaagattagctttctggcatgccatgttatc
agtattggatcaaacattggtgcaagtagccctgatgcaaattctaacaaccgagaaact
gaactacagatggctgctaatttacaagctaataatgtataccaagataatgaaagagat
caagaagtattcttgaacagtttgagttcagatgaaataaatgagctgaaggaaatggta
aaggatgaacatatttatgataaattggtcagatctattgctccagctgtgtttggccat
gaagccgtaaagaagggtatcttgcttcagatgctcggtggtgttcataagagtactgta
gaaggtattaagttaagaggagatatcaacatctgtgttgttggtgatccctctacttct
aagtctcaatttttaaaatacgtagtgggatttgcaccaagatcagtttacacttccggt
aaggcctcgtcggctgctggtttaacagctgcggttgtgagagatgaggaaggaggtgat
tatacaattgaagcaggtgctttaatgcttgctgataacggtatttgttgtatcgatgaa
tttgataaaatggatatttcagatcaagttgccattcatgaagctatggaacaacagacc
atctctattgctaaagctggtattcacgctactttaaatgcaagaacatcaattctagcg
gctgccaacccggtaggtggaagatacaataggaaactatcactgaggggtaatttaaat
atgaccgcaccgatcatgtccagatttgatttattttttgttattcttgatgactgtaac
gaaaaaattgataccgaattggcatctcatatcgttgacttacacatgaaaagagacgaa
gccattgagccgccatttagtgcagaacaactacgtcgttatatcaaatatgcacgtact
tttaaaccaatattaacgaaagaagcccgttcctatttagtcgagaagtataaggaactg
agaaaggatgatgcccagggatttagtagatcgagttatagaatcacagttaggcaactt
gaaagtatgattagattatcagaagctattgcgagggctaattgtgtcgatgaaattact
ccatcattcattgcagaagcttacgatcttttaaggcaaagtattattcgtgttgatgtg
gatgatgtggaaatggatgaagaatttgataacatagagagtcaaagtcacgccgcttct
ggaaacaatgatgacaatgatgatgggactgggtcaggtgtaattacgagtgagccacca
gcagatatagaagaaggacaaagcgaagctacagctcgtccaggtacaagcgagaagaag
aaaacaacggtgacgtatgataaatatgtgtccatgatgaacatgatcgttagaaagatt
gctgaagtagatagggagggtgcagaagaactaacagctgtggatatagttgattggtat
ttattacagaaggaaaatgatttgggttcgttagcagaatattgggaagagagaagatta
gcgttcaaagtcataaaaaggttggtcaaagataggattttaatggagattcatggtacc
agacacaatttaagagatcttgagaatgaggaaaatgaaaataataaaactgtttatgtt
attcatccaaactgtgaggttttggatcaattggaaccacaggattccagctaa

DBGET integrated database retrieval system