KEGG   Saccharomyces cerevisiae (budding yeast): YGL201CHelp
Entry
YGL201C           CDS       T00005                                 

Gene name
MCM6
Definition
Mcm6p (EC:3.6.4.12)
Orthology
K02542  
DNA replication licensing factor MCM6 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
DNA replication
Cell cycle - yeast
Meiosis - yeast
Module
MCM complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:sce03030]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:complement(117854..120907)
Genome map
AA seq 1017 aa AA seqDB search
MSSPFPADTPSSNRPSNSSPPPSSIGAGFGSSSGLDSQIGSRLHFPSSSQPHVSNSQTGP
FVNDSTQFSSQRLQTDGSATNDMEGNEPARSFKSRALNHVKKVDDVTGEKVREAFEQFLE
DFSVQSTDTGEVEKVYRAQIEFMKIYDLNTIYIDYQHLSMRENGALAMAISEQYYRFLPF
LQKGLRRVVRKYAPELLNTSDSLKRSEGDEGQADEDEQQDDDMNGSSLPRDSGSSAAPGN
GTSAMATRSITTSTSPEQTERVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEV
RPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVR
IQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSST
LDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRET
ELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGH
EAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSG
KASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQT
ISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCN
EKIDTELASHIVDLHMKRDEAIEPPFSAEQLRRYIKYARTFKPILTKEARSYLVEKYKEL
RKDDAQGFSRSSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDV
DDVEMDEEFDNIESQSHAASGNNDDNDDGTGSGVITSEPPADIEEGQSEATARPGTSEKK
KTTVTYDKYVSMMNMIVRKIAEVDREGAEELTAVDIVDWYLLQKENDLGSLAEYWEERRL
AFKVIKRLVKDRILMEIHGTRHNLRDLENEENENNKTVYVIHPNCEVLDQLEPQDSS
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccccttttccagctgacacaccaagcagtaatagaccttccaactcctctccg
ccaccatcgtcgataggtgctggcttcggaagcagtagcggactcgattcgcaaataggc
tctaggttacatttcccaagttcttctcaaccgcatgtcagtaattcacaaacaggccct
tttgttaacgattccactcagtttagttctcaaaggttgcaaaccgatggttccgcgact
aatgatatggagggaaatgaacctgccagaagcttcaaaagtagagctttgaatcacgtt
aagaaagttgatgacgttactggtgaaaaagtccgtgaagcgttcgagcagtttttggaa
gacttttccgttcaatccactgatactggtgaagttgaaaaagtttatagagctcaaatt
gaatttatgaaaatatatgacctaaacaccatttatatagattatcagcatttatccatg
agagaaaatggtgctctagctatggctatctcagaacaatattacagatttttgcctttt
ttacaaaagggtttaagaagagtagtaagaaagtatgcacctgaattgttaaacacaagt
gactcattgaagagatccgaaggtgacgaaggtcaagcggatgaagatgagcaacaggac
gatgatatgaatgggtcgagtctaccaagagattctggatcatcagccgcaccagggaat
gggacatctgccatggcaacgaggtcaataacaacttctacgtcacctgaacagacggaa
cgtgtttttcaaatcagtttcttcaatctaccaacagttcacagaattcgtgatataaga
tctgaaaagattggttcactattgagtatatcagggacagtgacaagaacatctgaggtc
cgtccagaattatacaaggcaagctttacgtgtgatatgtgccgtgctatcgtagataac
gtagaacagtccttcaagtacactgaaccgacattttgcccgaacccatcatgcgaaaat
agagccttttggacattaaatgttacaagatccaggtttcttgattggcaaaaagtcaga
attcaagaaaatgctaacgaaatacctacaggctccatgccgcgtacgctggacgtcatt
cttcgaggtgatagtgtcgaaagagccaagccaggtgaccgttgcaaatttacgggtgtg
gaaattgtagtacctgatgttacacaattggggctaccaggtgtgaagccaagttcaaca
ttagatactagaggtatttcgaagactactgaaggtttgaatagtggtgttactggttta
cgctctcttggtgttcgtgatttgacatacaagattagctttctggcatgccatgttatc
agtattggatcaaacattggtgcaagtagccctgatgcaaattctaacaaccgagaaact
gaactacagatggctgctaatttacaagctaataatgtataccaagataatgaaagagat
caagaagtattcttgaacagtttgagttcagatgaaataaatgagctgaaggaaatggta
aaggatgaacatatttatgataaattggtcagatctattgctccagctgtgtttggccat
gaagccgtaaagaagggtatcttgcttcagatgctcggtggtgttcataagagtactgta
gaaggtattaagttaagaggagatatcaacatctgtgttgttggtgatccctctacttct
aagtctcaatttttaaaatacgtagtgggatttgcaccaagatcagtttacacttccggt
aaggcctcgtcggctgctggtttaacagctgcggttgtgagagatgaggaaggaggtgat
tatacaattgaagcaggtgctttaatgcttgctgataacggtatttgttgtatcgatgaa
tttgataaaatggatatttcagatcaagttgccattcatgaagctatggaacaacagacc
atctctattgctaaagctggtattcacgctactttaaatgcaagaacatcaattctagcg
gctgccaacccggtaggtggaagatacaataggaaactatcactgaggggtaatttaaat
atgaccgcaccgatcatgtccagatttgatttattttttgttattcttgatgactgtaac
gaaaaaattgataccgaattggcatctcatatcgttgacttacacatgaaaagagacgaa
gccattgagccgccatttagtgcagaacaactacgtcgttatatcaaatatgcacgtact
tttaaaccaatattaacgaaagaagcccgttcctatttagtcgagaagtataaggaactg
agaaaggatgatgcccagggatttagtagatcgagttatagaatcacagttaggcaactt
gaaagtatgattagattatcagaagctattgcgagggctaattgtgtcgatgaaattact
ccatcattcattgcagaagcttacgatcttttaaggcaaagtattattcgtgttgatgtg
gatgatgtggaaatggatgaagaatttgataacatagagagtcaaagtcacgccgcttct
ggaaacaatgatgacaatgatgatgggactgggtcaggtgtaattacgagtgagccacca
gcagatatagaagaaggacaaagcgaagctacagctcgtccaggtacaagcgagaagaag
aaaacaacggtgacgtatgataaatatgtgtccatgatgaacatgatcgttagaaagatt
gctgaagtagatagggagggtgcagaagaactaacagctgtggatatagttgattggtat
ttattacagaaggaaaatgatttgggttcgttagcagaatattgggaagagagaagatta
gcgttcaaagtcataaaaaggttggtcaaagataggattttaatggagattcatggtacc
agacacaatttaagagatcttgagaatgaggaaaatgaaaataataaaactgtttatgtt
attcatccaaactgtgaggttttggatcaattggaaccacaggattccagctaa

DBGET integrated database retrieval system