KEGG   Saccharomyces cerevisiae (budding yeast): YGL240WHelp
Entry
YGL240W           CDS       T00005                                 

Gene name
DOC1, APC10
Definition
anaphase promoting complex subunit DOC1
Orthology
K03357  
anaphase-promoting complex subunit 10
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YGL240W (DOC1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YGL240W (DOC1)
   04113 Meiosis - yeast
    YGL240W (DOC1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     YGL240W (DOC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VII:48613..49365
Genome map
AA seq 250 aa AA seqDB search
MDPIGINKVLDHLAPSELIKPVKSCHNKPSVLVLDDRIVDAATKDLYVNGFQEEIQYQNP
TPENLQHMFHQGIEILDSARMINVTHLALWKPSSFKLGNPVDFALDDNYDTFWQSDGGQP
HQLDIMFSKRMDICVMAIFFSMIADESYAPSLVKVYAGHSPSDARFYKMLEVRNVNGWVA
LRFLDNREDDQLLKCQFIRLLFPVNHENGKDTHLRGIRLYVPSNEPHQDTHEWAQTLPET
NNVFQDAILR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggacccgattggaataaacaaagtcttggaccatttagcaccctcagagcttatcaaa
cctgttaagagttgccataataaaccttcagtgttggtgttggatgacaggattgtggat
gcggcaaccaaagatctctacgtgaatgggttccaagaagagattcagtatcagaatcct
acaccggagaacttgcaacatatgttccaccaaggtattgaaatattggattcggcaagg
atgatcaacgtgacacatttagcgctttggaagccttcttcttttaagttggggaatcct
gtggactttgctctagatgataactacgatacgttttggcagagcgatggagggcaacca
caccaattggacattatgtttagtaagagaatggacatctgtgtcatggcaatattcttt
tcgatgattgcggacgagtcctatgctccaagcttagtgaaagtttacgcggggcatagt
ccttctgatgcgaggttttataagatgcttgaagtgagaaatgtgaatggctgggtggca
ctaaggtttctagataatagggaggacgaccagctgctgaaatgtcaattcatcaggctt
ttgtttccagtcaaccatgaaaacggaaaagatacacatctgagaggcataaggctatat
gttccatctaatgagccacatcaagatacccatgagtgggcacagaccctcccagaaact
aacaatgtcttccaggatgctatattacgttaa

DBGET integrated database retrieval system