KEGG   Saccharomyces cerevisiae (budding yeast): YGR040WHelp
Entry
YGR040W           CDS       T00005                                 

Gene name
KSS1
Definition
mitogen-activated serine/threonine-protein kinase KSS1 (EC:2.7.11.24)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YGR040W (KSS1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     YGR040W (KSS1)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   YGR040W (KSS1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YGR040W (KSS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:575398..576504
Genome map
AA seq 368 aa AA seqDB search
MARTITFDIPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREI
KLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHV
QYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVG
FMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILE
VLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDK
RISAAEALRHPYLAMYHDPSDEPEYPPLNLDDEFWKLDNKIMRPEEEEEVPIEMLKDMLY
DELMKTME
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggctagaaccataacttttgatatcccttcccaatataaactcgtagatttaataggt
gagggagcgtacggaacagtatgttcagcaattcataagccttccggcataaaggtagct
atcaagaaaatacaaccgtttagcaaaaaattgtttgttacaagaactatacgtgagatc
aagcttttacggtatttccatgaacacgaaaacataataagtatattggataaagtaagg
ccagtatccatagacaaactaaacgctgtttatttagtcgaagagttgatggaaaccgat
ttacaaaaagtaattaataatcagaatagcgggttttccactttaagtgatgaccatgtt
caatactttacataccaaatcctcagagccttaaagtctattcacagtgcacaagttatc
catagagacataaagccatcaaacctgttactaaattccaattgtgatctcaaagtctgc
gattttggactagcgaggtgtttagctagcagtagcgattcaagagaaacattggtagga
ttcatgacggagtacgtcgcaacgcgatggtacagggcacccgagataatgctaactttt
caagagtacacaactgcgatggatatatggtcatgcggatgcattttggctgaaatggtc
tccgggaagcctttgttcccaggcagagactatcatcatcaattatggctaattctagaa
gtcttgggaactccatctttcgaagactttaatcagatcaaatccaagagggctaaagag
tatatagcaaacttacctatgaggccacccttgccatgggagaccgtctggtcaaagacc
gatctgaatccagatatgatagatttactagacaaaatgcttcaattcaatcctgacaaa
agaataagcgcagcagaagctttaagacacccttacctggcaatgtaccatgacccaagt
gatgagccggaatatcctccacttaatttggatgatgaattttggaaactggataacaag
ataatgcgtccggaagaggaggaagaagtgcccatagaaatgctcaaagacatgctttac
gatgaactaatgaagaccatggaatag

DBGET integrated database retrieval system