KEGG   Saccharomyces cerevisiae (budding yeast): YGR108WHelp
Entry
YGR108W           CDS       T00005                                 

Gene name
CLB1, SCB1
Definition
(RefSeq) B-type cyclin CLB1
  KO
K02220  G2/mitotic-specific cyclin 1/2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Module
sce_M00693  Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:sce00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    YGR108W (CLB1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YGR108W (CLB1)
   04113 Meiosis - yeast
    YGR108W (CLB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 853002
NCBI-ProteinID: NP_011622
SGD: S000003340
UniProt: P24868
Position
VII:703636..705051
Genome map
AA seq 471 aa AA seqDB search
MSRSLLVENSRTINSNEEKGVNESQYILQKRNVPRTILGNVTNNANILQEISMNRKIGMK
NFSKLNNFFPLKDDVSRADDFTSSFNDSRQGVKQEVLNNKENIPEYGYSEQEKQQCSNDD
SFHTNSTALSCNRLIYSENKSISTQMEWQKKIMREDSKKKRPISTLVEQDDQKKFKLHEL
TTEEEVLEEYEWDDLDEEDCDDPLMVSEEVNDIFDYLHHLEIITLPNKANLYKHKNIKQN
RDILVNWIIKIHNKFGLLPETLYLAINIMDRFLCEEVVQLNRLQLVGTSCLFIASKYEEI
YSPSIKHFAYETDGACSVEDIKEGERFILEKLDFQISFANPMNFLRRISKADDYDIQSRT
LAKFLMEISIVDFKFIGILPSLCASAAMFLSRKMLGKGTWDGNLIHYSGGYTKAKLYPVC
QLLMDYLVGSTIHDEFLKKYQSRRFLKASIISIEWALKVRKNGYDIMTLHE
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgatcccttttggtagagaatagtagaaccattaatagtaatgaagagaagggg
gtaaacgaaagtcaatatatcttacaaaagagaaacgtcccaaggaccattctcggtaat
gtcacaaataatgcaaatatcctgcaagagatttctatgaacagaaaaattgggatgaag
aacttctcaaaattgaacaacttctttcctttaaaggatgatgtttcgagagccgatgac
ttcacctcctcttttaatgacagtagacagggggtgaaacaagaagtactaaacaataag
gaaaatattcctgaatatggatattccgagcaagaaaagcagcagtgctcaaatgatgac
tcttttcatacgaattcgactgccttgagctgtaatcggttgatatactctgagaacaag
tctatttccactcaaatggaatggcagaaaaaaataatgagagaagattccaaaaaaaaa
aggccaatatcaactcttgtagagcaggatgaccagaaaaagttcaaactccatgaattg
actacagaagaagaggttctggaggagtacgaatgggatgacctagatgaagaagattgt
gatgatcccttaatggtgagcgaagaggttaatgatatcttcgattatttgcatcacttg
gaaataatcacattgccaaataaggcgaatctctataagcataaaaatattaagcaaaac
agagacattttggtgaactggataatcaagattcataataagtttggccttctgccggaa
actctatatttggccataaacataatggatagatttctttgtgaagaggtggttcagtta
aatagattgcaactggttggtacatcatgcctgttcatcgcatctaagtatgaggaaata
tactcccctagcataaaacattttgcgtacgagacagacggtgcatgctctgtggaagat
attaaagagggtgaaagatttatattggaaaaactcgattttcaaattagtttcgctaac
ccaatgaatttcttaaggagaatatcaaaagcggatgactatgatatccagtctaggacg
ttagcgaagttcctaatggaaatatctatagtggacttcaagttcatcgggatattaccg
tcattatgtgcctcagcggcaatgttcctttcgagaaaaatgctgggcaagggcacctgg
gatggcaacttaatccattatagtggtggttacacaaaggcaaaactatatcccgtttgc
caattactgatggattatcttgttggatctactattcacgacgagttcttgaaaaaatat
caatcgagaagatttttaaaggcttccataatttctatcgaatgggcattgaaggtaagg
aaaaatggatatgatattatgacattgcatgagtga

DBGET integrated database retrieval system