KEGG   Saccharomyces cerevisiae (budding yeast): YGR108WHelp
Entry
YGR108W           CDS       T00005                                 

Gene name
CLB1, SCB1
Definition
Clb1p
Orthology
K02220  
G2/mitotic-specific cyclin 1/2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YGR108W (CLB1)
   04113 Meiosis - yeast
    YGR108W (CLB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:703636..705051
Genome map
AA seq 471 aa AA seqDB search
MSRSLLVENSRTINSNEEKGVNESQYILQKRNVPRTILGNVTNNANILQEISMNRKIGMK
NFSKLNNFFPLKDDVSRADDFTSSFNDSRQGVKQEVLNNKENIPEYGYSEQEKQQCSNDD
SFHTNSTALSCNRLIYSENKSISTQMEWQKKIMREDSKKKRPISTLVEQDDQKKFKLHEL
TTEEEVLEEYEWDDLDEEDCDDPLMVSEEVNDIFDYLHHLEIITLPNKANLYKHKNIKQN
RDILVNWIIKIHNKFGLLPETLYLAINIMDRFLCEEVVQLNRLQLVGTSCLFIASKYEEI
YSPSIKHFAYETDGACSVEDIKEGERFILEKLDFQISFANPMNFLRRISKADDYDIQSRT
LAKFLMEISIVDFKFIGILPSLCASAAMFLSRKMLGKGTWDGNLIHYSGGYTKAKLYPVC
QLLMDYLVGSTIHDEFLKKYQSRRFLKASIISIEWALKVRKNGYDIMTLHE
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgatcccttttggtagagaatagtagaaccattaatagtaatgaagagaagggg
gtaaacgaaagtcaatatatcttacaaaagagaaacgtcccaaggaccattctcggtaat
gtcacaaataatgcaaatatcctgcaagagatttctatgaacagaaaaattgggatgaag
aacttctcaaaattgaacaacttctttcctttaaaggatgatgtttcgagagccgatgac
ttcacctcctcttttaatgacagtagacagggggtgaaacaagaagtactaaacaataag
gaaaatattcctgaatatggatattccgagcaagaaaagcagcagtgctcaaatgatgac
tcttttcatacgaattcgactgccttgagctgtaatcggttgatatactctgagaacaag
tctatttccactcaaatggaatggcagaaaaaaataatgagagaagattccaaaaaaaaa
aggccaatatcaactcttgtagagcaggatgaccagaaaaagttcaaactccatgaattg
actacagaagaagaggttctggaggagtacgaatgggatgacctagatgaagaagattgt
gatgatcccttaatggtgagcgaagaggttaatgatatcttcgattatttgcatcacttg
gaaataatcacattgccaaataaggcgaatctctataagcataaaaatattaagcaaaac
agagacattttggtgaactggataatcaagattcataataagtttggccttctgccggaa
actctatatttggccataaacataatggatagatttctttgtgaagaggtggttcagtta
aatagattgcaactggttggtacatcatgcctgttcatcgcatctaagtatgaggaaata
tactcccctagcataaaacattttgcgtacgagacagacggtgcatgctctgtggaagat
attaaagagggtgaaagatttatattggaaaaactcgattttcaaattagtttcgctaac
ccaatgaatttcttaaggagaatatcaaaagcggatgactatgatatccagtctaggacg
ttagcgaagttcctaatggaaatatctatagtggacttcaagttcatcgggatattaccg
tcattatgtgcctcagcggcaatgttcctttcgagaaaaatgctgggcaagggcacctgg
gatggcaacttaatccattatagtggtggttacacaaaggcaaaactatatcccgtttgc
caattactgatggattatcttgttggatctactattcacgacgagttcttgaaaaaatat
caatcgagaagatttttaaaggcttccataatttctatcgaatgggcattgaaggtaagg
aaaaatggatatgatattatgacattgcatgagtga

DBGET integrated database retrieval system