KEGG   Saccharomyces cerevisiae (budding yeast): YGR109CHelp
Entry
YGR109C           CDS       T00005                                 

Gene name
CLB6
Definition
Clb6p
Orthology
K06651  
S-phase entry cyclin 5/6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YGR109C (CLB6)
   04113 Meiosis - yeast
    YGR109C (CLB6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:complement(705359..706501)
Genome map
AA seq 380 aa AA seqDB search
MNCIPSPISERKIQINNEDCIGKENAFHTIPRESSINLTPHSTNEKKVLSEVNSNKIDSL
QLPRGKLQRDSTHLEKTRKRQLSNDSTDPIEPKTVKKIKCHQWKNLDSIEMDDPFMVAEY
TDSIFSHLYEKEIQMLPTHNYLMDTQSPYHLKSSMRALLIDWLVEVHEKFHCLPETLFLA
INLLDRFLSQNVVKLNKLQLLCITCLFIACKFEEVKLPKITNFAYVTDGAATVEGIRKAE
LFVLSSLGYNISLPNPLNFIRRISKADNYCIETRNMAKFIMEYSICCNKFIHLKPSYLAA
MSMYIARKIKNENSKWDETFIHYSGGIDIESDPAFKDFISELVEDIAVPDTNLDSLRLKY
KKPKHGMVYFKVFDWCKQKR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtatccctagtccaattagtgaaaggaaaatccaaattaataatgaagattgt
ataggcaaggaaaatgctttccataccattccaagagaaagttcaattaacttgacacct
cactctacgaatgaaaaaaaagttctatccgaggtaaacagtaacaaaatcgattcttta
caactccctcgaggtaaattgcaaagagattccacccatttggaaaaaacaagaaagaga
caattatcaaatgattcaaccgatcctatagagccaaaaactgtgaaaaaaataaaatgt
catcaatggaaaaatttggattcgatagagatggatgatccattcatggtagcagaatat
acagattctatattttctcatctttacgagaaggaaatccaaatgctaccgacacataac
tatttaatggacacgcaatctccctatcatttgaaaagctccatgagggcgctgttaatt
gactggttggttgaagttcatgagaaatttcactgcttacctgaaacattatttttagcg
atcaacctgctagatcgatttttatcacaaaatgttgttaaattgaataaattacaacta
ctatgcatcacttgcctgttcattgcctgtaaatttgaagaagttaaattaccaaaaata
acaaattttgcgtacgtgactgacggtgctgccactgtcgaaggaattaggaaggctgag
ctattcgttctaagttctttaggttataacatatctctaccaaaccccctaaatttcatt
aggagaatttcaaaagctgacaattactgcattgaaacaaggaacatggccaaattcatc
atggaatattcgatttgttgtaataaattcatccacctgaagccatcatatttagctgca
atgtccatgtatatcgccagaaaaattaaaaatgaaaattccaaatgggatgaaactttt
attcattatagtggcggcattgatattgaatcagatccagcgtttaaggattttatcagt
gaactagttgaagatattgctgtacctgatacgaatctagattccttgagacttaaatac
aaaaagcctaaacatggcatggtttatttcaaggtttttgactggtgtaaacaaaaacgt
tga

DBGET integrated database retrieval system