KEGG   Saccharomyces cerevisiae (budding yeast): YGR109W-BHelp
Entry
YGR109W-B         CDS       T00005                                 

Definition
gag-pol fusion protein (EC:2.7.7.49 2.7.7.7 3.4.23.- 3.1.26.4)
Orthology
K07497  
putative transposase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VII:join(707610..708459,708461..712254)
Genome map
AA seq 1547 aa AA seqDB search
MSFMDQIPGGGNYPKLPVECLPNFPIQPSLTFRGRNDSHKLKNFISEIMLNMSMISWPND
ASRIVYCRRHLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQL
SEAKLGIERLNQRFRKIWDRMPPDFMTEKAAIMTYTRLLTKETYNIVRMHKPETLKDAME
EAYQTTALTERFFPGFELDADGDTIIGATTHLQEEYDSDYDSEDNLTQNGYVHTVRTRRS
YNKPMSNHRNRRNNNPSREECIKNRLCFYCKKEGHRLNECRARRRVLTDLELESKDQQTP
FIKTLPIVHYIAIPEMDNTAEKTIKIQNTKVKTLFDSGSPTSFIRRDIVELLKYEIYETP
PLRFRGFVATKSAVTSEAVTIDLKINDLHITLAAYILDNMDYQLLIGNPILRRYPKILHT
VLNTRESPDSLKPKTYRSETVNNVRTYSAGNRGNPRNIKLSFAPTILEATDPKSAGNRGD
SRTKTLSLATTTPAAIDPLTTLDNPGSTQSTFAQFPIPEEASILEEDGKYSNVVSTIQSV
EPNATDHSNKDTFCTLPVWLQQKYREIIRNDLPPRPADINNIPVKHDIEIKPGARLPRLQ
PYHVTEKNEQEINKIVQKLLDNKFIVPSKSPCSSPVVLVPKKDGTFRLCVDYRTLNKATI
SDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPF
GLVNAPSTFARYMADTFRDLRFVNVYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKK
KKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPN
CSKIAQPIQLFICDKSQWTEKQDKAIDKLKDALCNSPVLVPFNNKANYRLTTDASKDGIG
AVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRT
DHISLLSLQNKNEPARRVQRWLDDLATYDFTLEYLAGPKNVVADAISRAVYTITPETSRP
IDTESWKSYYKSDPLCSAVLIHMKELTQHNVTPEDMSAFRSYQKKLELSETFRKNYSLED
EMIYYQDRLVVPIKQQNAVMRLYHDHTLFGGHFGVTVTLAKISPIYYWPKLQHSIIQYIR
TCVQCQLIKSHRPRLHGLLQPLPIAEGRWLDISMDFVTGLPPTSNNLNMILVVVDRFSKR
AHFIATRKTLDATQLIDLLFRYIFSYHGFPRTITSDRDVRMTADKYQELTKRLGIKSTMS
SANHPQTDGQSERTIQTLNRLLRAYASTNIQNWHVYLPQIEFVYNSTPTRTLGKSPFEID
LGYLPNTPAIKSDDEVNARSFTAVELAKHLKALTIQTKEQLEHAQIEMETNNNQRRKPLL
LNIGDHVLVHRDAYFKKGAYMKVQQIYVGPFRVVKKINDNAYELDLNSHKKKHRVINVQF
LKKFVYRPDAYPKNKPISSTERIKRAHEVTALIGIDTTHKTYLCHMQDVDPTLSVEYSEA
EFCQIPERTRRSILANFRQLYETQDNPEREEDVVSQNEICQYDNTSP
NT seq 4644 nt NT seq  +upstreamnt  +downstreamnt
atgagctttatggatcaaatcccaggaggaggaaattatccaaaactcccagtagaatgc
cttcctaacttcccgatccaaccatctttgaccttcagaggtagaaatgactcgcataaa
ctgaaaaactttatctccgaaataatgttaaacatgtctatgatatcttggccgaatgat
gccagtcgtattgtgtactgcagaagacatttattaaaccccgctgctcagtgggctaat
gactttgtacaagaacaaggtatacttgaaataacattcgacacattcatacaaggatta
tatcagcatttctataagccaccagatatcaataaaatctttaatgcaatcacgcaactt
tccgaagctaaacttggtattgagcgtctcaaccaacgattcagaaagatttgggacaga
atgccaccagacttcatgaccgaaaaagctgccataatgacatatactaggctattgaca
aaggaaacctataatattgtcagaatgcacaaaccagagacattaaaagacgccatggaa
gaggcttaccagacaactgcactaactgaaagattcttcccaggattcgaacttgatgct
gatggagacactatcatcggtgccacaacccacttacaagaagaatacgactctgactat
gattcagaagataatctgacccagaatggatacgtccataccgtaaggacaagaagatct
tacaataaaccaatgtcaaatcatcgaaacaggagaaataacaacccatctagagaagaa
tgtataaaaaatcggctatgcttctattgtaagaaagagggacatcgcctgaacgaatgt
agagcacgtaggcgagttctaaccgatcttgaactcgaatcaaaagaccaacaaactcct
tttatcaaaaccttaccaattgtacactatatcgccatccccgagatggacaataccgcc
gaaaaaaccataaaaatacaaaacacgaaagtaaaaaccctgtttgacagtggatcaccc
acgtcatttatccgaagagatattgtagaacttctcaaatacgaaatctacgagacccct
ccactccgttttagaggattcgtagccaccaaatccgccgttacatccgaagcagtcacc
attgacctcaaaatcaatgacctgcatataactttagccgcgtacatactggataacatg
gactaccaattgttaattggaaatccaatcttacgccgctacccgaaaatcctgcacaca
gtactgaataccagagagagccccgactccttaaagcccaagacttatcgctccgaaacc
gttaataacgttagaacctactccgctggtaatcgtggtaaccccagaaacataaaactg
tcttttgcccccaccattctcgaagcaactgacccgaaatccgctggtaatcgtggtgac
tccagaaccaaaaccctgtctcttgcaaccactactcctgcagcaattgacccgcttacg
acccttgataacccaggtagtactcaaagtacatttgcgcaattcccgatacctgaagaa
gcgagcatcctagaagaggatggaaaatactccaacgttgtctcaaccattcagagtgta
gaacctaatgctactgatcacagcaataaggacaccttttgcactttgccagtttggtta
caacagaagtatagagagatcatacgtaatgatctcccaccaagacctgccgacattaat
aacatccccgtaaaacatgatattgaaattaaacctggcgcaagactacctcgactacag
ccataccatgttacagaaaagaacgaacaagaaatcaacaaaatagttcaaaaactgctc
gataacaagttcattgttccctcaaagtcgccttgcagctcccctgtagtcctcgtcccg
aagaaagacggtaccttccgactctgcgtcgattaccgcaccctgaacaaagctaccatc
tccgacccattcccattacccagaatcgacaacctattgagccgtattggaaatgcccag
atatttaccacgctagatttgcatagtggttaccaccagatcccgatggaacccaaagac
cgctacaaaaccgcctttgtcacaccatccggtaagtatgaatataccgtcatgccattt
ggcttagtcaatgcacctagtacattcgcaagatacatggctgatacatttagagacctg
agattcgtcaatgtttaccttgatgatatattaatattctccgaatctccagaagaacat
tggaaacatttagacacggtactagaaagattaaagaacgagaacctcattgttaagaag
aaaaaatgtaaatttgcatctgaagaaactgagtttttaggctatagtattggaatccag
aaaatagctccactacagcacaaatgtgcagcaatccgagactttccgacgcctaaaaca
gtaaaacaagcacagagatttttaggaatgattaattactacagacgattcattccaaat
tgctccaagattgcacagccaatccaactgtttatttgtgacaaaagtcaatggacagaa
aaacaagacaaggcaattgataaactaaaagacgccttgtgtaactcccccgtcctagta
ccattcaacaacaaagcaaactaccgacttacaacagacgcctcaaaagacggcattggt
gctgttctagaagaagtcgacaacaagaacaaacttgttggtgtcgtcggttacttctct
aaatccttagagagtgcccagaaaaactatcctgctggcgaattagaactacttggaatt
atcaaagcactccaccacttccgatatatgcttcacggaaagcatttcacgttaagaaca
gaccacattagtttgttatcattacaaaacaagaacgaacccgcacgacgcgtgcaacgc
tggttagatgacctagccacatatgacttcaccttagaatacctagctggacccaagaac
gttgtcgcagatgccatatcccgtgccgtatatactataacccccgaaacatcccgacct
atcgacacagaaagctggaaatcttactacaaatcagacccattatgtagtgctgtctta
attcatatgaaagaattgacacaacacaacgtcacacctgaagatatgtcagccttccgt
agttaccagaagaaactcgaactatcagagaccttccgaaagaattattccctagaagac
gaaatgatctattaccaagaccgactagtagtaccaataaaacaacagaacgcagttatg
agactatatcatgaccataccttatttggaggacattttggtgtaacagtgacccttgcg
aaaatcagcccaatttactattggccaaaattacaacattcgatcatacaatacatcagg
acctgcgtacaatgtcaactaataaaatcacaccgaccacgcttacatggactattacaa
ccactccctatagcagaaggaagatggcttgatatatcaatggattttgtgacaggatta
cccccgacatcaaataacttgaatatgatcctcgtcgtagttgatcgtttttcgaaacgc
gctcacttcatagctacaaggaaaaccttagacgcaacacaactaatagatctactcttt
cgatacattttttcatatcatggttttcccaggacaataaccagtgatagagatgtccgt
atgaccgccgacaaatatcaagaactcacgaaaagactaggaataaaatcgacaatgtct
tccgcgaaccacccccaaacagatggacaatccgaacgaacgatacagacattaaacagg
ttactaagagcctatgcttcaaccaatattcagaattggcatgtatatttaccacaaatc
gaatttgtttacaattctacacctactagaacacttggaaaatcaccatttgaaattgat
ttaggatatttaccgaatacccctgctattaagtcagatgacgaagtcaacgcaagaagt
tttactgccgtagaacttgccaaacacctcaaagcccttaccatccaaacgaaggaacag
ctagaacacgctcaaatcgaaatggaaactaataacaatcaaagacgtaaacccttattg
ttaaacataggagatcacgtattagtgcatagagatgcatacttcaagaaaggtgcttat
atgaaagtacaacaaatatacgtcggaccatttcgagttgtcaagaaaataaacgataac
gcctacgaactagatttaaactctcacaagaaaaagcacagagttattaatgtacaattc
ctgaaaaagtttgtataccgtccagacgcgtacccaaagaataaaccaatcagctccact
gaaagaattaagagagcacacgaagttactgcactcataggaatagatactacacacaaa
acttacttatgtcacatgcaagatgtagacccaacactttcagtagaatactcagaagct
gaattttgccaaattcccgaaagaacacgaagatcaatattagccaactttagacaactc
tacgaaacacaagacaaccctgagagagaggaagatgttgtatctcaaaatgagatatgt
cagtatgacaatacgtcaccctga

DBGET integrated database retrieval system