KEGG   Saccharomyces cerevisiae (budding yeast): YGR113WHelp
Entry
YGR113W           CDS       T00005                                 

Gene name
DAM1
Definition
Dam1p
Orthology
K02307  
DASH complex subunit DAM1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YGR113W (DAM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:718893..719924
Genome map
AA seq 343 aa AA seqDB search
MSEDKAKLGTTRSATEYRLSIGSAPTSRRSSMGESSSLMKFADQEGLTSSVGEYNENTIQ
QLLLPKIRELSDSIITLDSNFTRLNFIHESLADLNESLGSLLYGIMSNSWCVEFSQAPHD
IQDDLIAIKQLKSLEDEKNNLVMELSNMERGIKRKKDEQGENDLAKASQNKQFNQPLFPS
SQVRKYRSYDNRDKRKPSKIGNNLQVENEEDYEDDTSSEASFVLNPTNIGMSKSSQGHVT
KTTRLNNNTNSKLRRKSILHTIRNSIASGADLPIENDNVVNLGDLHPNNRISLGSGAARV
VNGPVTKNRNSMFSGRAERKPTESRHSVAKKTEKKINTRPPFR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagataaagctaaattagggaccacaaggtctgccacggaatatcgtttatcc
attggtagcgctccgacttcaagaaggtcgtctatgggtgaatcctcatccctgatgaaa
tttgctgatcaagagggattaacgagttccgttggcgaatataacgagaataccatacaa
cagcttctgttgcctaaaataagagaactgagcgattcaatcattactttagattccaat
ttcacgcgcttaaattttatccacgagagtttagctgatcttaatgaatccctaggttcg
ttgttgtacggtattatgagcaattcatggtgcgtagaattctcacaggcgcctcatgat
attcaagacgatttgatcgctattaaacaattgaaatcgttggaagatgagaaaaataac
ttagtaatggaactctccaatatggaacgcgggattaaaagaaaaaaagacgaacaaggt
gaaaatgatttggccaaggcatctcagaacaaacagtttaaccagccgctatttccctcc
tcacaagtaagaaaatacaggtcatatgacaacagagacaagaggaagccctccaagata
ggcaacaacttacaagtagagaatgaggaggactatgaagacgatactagtagtgaagct
tcttttgttctaaatccaacaaatatcggtatgtccaaatcatctcaaggtcacgtgact
aaaaccacgcgtttgaataataataccaacagtaaactgagaagaaagtccatcttacat
acaatcagaaatagcattgcttccggcgctgatttacccatcgaaaacgacaatgttgtt
aatttgggagatctgcatccaaataatcgaatatcactcggaagtggtgctgcaagagtg
gtcaatgggcccgttacgaagaacagaaattcaatgttctcaggacgtgctgaaaggaaa
cccacagaaagcagacattctgttgcaaagaaaactgaaaaaaaaataaatacaaggccc
cccttcagatga

DBGET integrated database retrieval system