KEGG   Saccharomyces cerevisiae (budding yeast): YGR167WHelp
Entry
YGR167W           CDS       T00005                                 

Gene name
CLC1, SCD4
Definition
Clc1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:832456..833157
Genome map
AA seq 233 aa AA seqDB search
MSEKFPPLEDQNIDFTPNDKKDDDTDFLKREAEILGDEFKTEQDDILETEASPAKDDDEI
RDFEEQFPDINSANGAVSSDQNGSATVSSGNDNGEADDDFSTFEGANQSTESVKEDRSEV
VDQWKQRRAVEIHEKDLKDEELKKELQDEAIKHIDDFYDSYNKKKEQQLEDAAKEAEAFL
KKRDEFFGQDNTTWDRALQLINQDDADIIGGRDRSKLKEILLRLKGNAKAPGA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaaattccctcctttggaagatcaaaacattgatttcacacccaacgacaaa
aaagatgacgacaccgattttttaaaaagagaagcagagatacttggagacgagttcaag
actgaacaggatgacatattggaaacggaggcttcccccgccaaagatgatgacgaaatt
agggattttgaagagcaatttccagatatcaactccgcaaatggcgcagtctcgagcgat
caaaatggtagtgctactgtatctagtggtaatgacaatggcgaggcagatgatgatttt
tccacattcgaaggtgccaatcagagtacagaatccgttaaagaggatcgttctgaagtt
gtagaccaatggaaacaacgtcgtgctgtagagattcacgaaaaggatttaaaggacgag
gagttaaaaaaggaattgcaggatgaagctatcaaacatattgacgatttttacgattct
tacaataaaaagaaggaacaacaattggaagatgctgctaaggaagctgaggctttctta
aagaaaagagatgaattttttggtcaagacaatacgacctgggatcgtgcacttcaatta
attaaccaagatgatgccgatatcattgggggtagagacaggtctaagcttaaagaaatt
cttttgagattgaaaggtaacgcgaaggctcccggtgcttaa

DBGET integrated database retrieval system