KEGG   Saccharomyces cerevisiae (budding yeast): YGR188CHelp
Entry
YGR188C           CDS       T00005                                 

Gene name
BUB1
Definition
Bub1p (EC:2.7.11.1)
Orthology
K02178  
checkpoint serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YGR188C (BUB1)
   04113 Meiosis - yeast
    YGR188C (BUB1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YGR188C (BUB1)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: Other group
  BUB family
   YGR188C (BUB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VII:complement(872044..875109)
Genome map
AA seq 1021 aa AA seqDB search
MNLDLGSTVRGYESDKDTFPQSKGVSSSQKEQHSQLNQTKIAYEQRLLNDLEDMDDPLDL
FLDYMIWISTSYIEVDSESGQEVLRSTMERCLIYIQDMETYRNDPRFLKIWIWYINLFLS
NNFHESENTFKYMFNKGIGTKLSLFYEEFSKLLENAQFFLEAKVLLELGAENNCRPYNRL
LRSLSNYEDRLREMNIVENQNSVPDSRERLKGRLIYRTAPFFIRKFLTSSLMTDDKENRA
NLNSNVGVGKSAPNVYQDSIVVADFKSETERLNLNSSKQPSNQRLKNGNKKTSIYADQKQ
SNNPVYKLINTPGRKPERIVFNFNLIYPENDEEFNTEEILAMIKGLYKVQRRGKKHTEDY
TSDKNRKKRKLDVLVERRQDLPSSQPPVVPKSTRIEVFKDDDNPSQSTHHKNTQVQVQTT
TSILPLKPVVDGNLAHETPVKPSLTSNASRSPTVTAFSKDAINEVFSMFNQHYSTPGALL
DGDDTTTSKFNVFENFTQEFTAKNIEDLTEVKDPKQETVSQQTTSTNETNDRYERLSNSS
TRPEKADYMTPIKETTETDVVPIIQTPKEQIRTEDKKSGDNTETQTQLTSTTIQSSPFLT
QPEPQAEKLLQTAEHSEKSKEHYPTIIPPFTKIKNQPPVIIENPLSNNLRAKFLSEISPP
LFQYNTFYNYNQELKMSSLLKKIHRVSRNENKNPIVDFKKTGDLYCIRGELGEGGYATVY
LAESSQGHLRALKVEKPASVWEYYIMSQVEFRLRKSTILKSIINASALHLFLDESYLVLN
YASQGTVLDLINLQREKAIDGNGIMDEYLCMFITVELMKVLEKIHEVGIIHGDLKPDNCM
IRLEKPGEPLGAHYMRNGEDGWENKGIYLIDFGRSFDMTLLPPGTKFKSNWKADQQDCWE
MRAGKPWSYEADYYGLAGVIHSMLFGKFIETIQLQNGRCKLKNPFKRYWKKEIWGVIFDL
LLNSGQASNQALPMTEKIVEIRNLIESHLEQHAENHLRNVILSIEEELSHFQYKGKPSRR
F
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagatttaggttctactgtacgaggctatgaatcagataaagacacatttccg
caatcgaaaggcgttagctcatctcaaaaagagcagcatagtcaactgaatcagacaaaa
atagcttatgaacagagacttctaaatgatttagaggatatggatgatcctttagatttg
tttttagattatatgatatggattagcaccagctatattgaagtagattctgaatcaggt
caagaagttctccgaagtacaatggaaagatgcttgatttacatacaagatatggaaacc
tataggaacgatcccagatttttaaaaatttggatttggtatataaatttgtttcttagc
aacaacttccacgagagtgaaaatacttttaaatatatgtttaacaagggaatcggaaca
aagctttcgttattttatgaagagttctccaagctactagaaaatgctcaattttttcta
gaagcaaaggtgttattagaactaggggctgaaaacaattgcaggccttacaacagacta
ttaaggtcattaagcaattatgaagacagactccgagaaatgaacatcgtagaaaaccag
aacagtgtacctgattcaagggaaagattgaagggaaggttaatttatagaacagcacca
tttttcattcgtaaatttttaacctcatcattgatgactgatgacaaggaaaatcgtgcg
aacctgaactctaatgttggagttggtaagtctgctcctaacgtatatcaagattctata
gtggttgctgactttaagtcagaaacagagaggcttaatttgaatagctctaaacagccc
tctaaccaacgcttgaagaatggaaataaaaaaacttcaatatatgcagatcaaaagcaa
tctaacaatccagtctacaaactaatcaatactccgggacggaaacctgaacggatagtt
tttaattttaatctaatatatccagaaaatgatgaggagttcaacaccgaagaaatattg
gcaatgattaagggactttacaaggtacagcgcagaggtaagaagcacaccgaagattat
acaagtgacaaaaataggaagaaacgtaagctcgatgtgctggtagagagacggcaagac
ttaccttcatcacagccacccgttgtccccaaatctacgcgaattgaggtgtttaaagat
gacgataatcccagccagagcacacaccataaaaatacacaggtacaagtgcaaacgaca
acgtctattttacctttgaagcctgtggttgatggaaacctcgcgcatgagacaccagtg
aagccctcactaacatccaacgcttcccgttcacctacagtaacagctttttcaaaagac
gctataaatgaggtcttttccatgttcaatcaacattattcaaccccgggtgcgctatta
gatggtgatgataccactacaagtaaattcaacgtcttcgaaaattttacccaagaattt
acagcaaagaatattgaagatttaactgaagttaaagatcctaaacaagagacggtgtca
caacaaactacctcaacaaatgaaaccaacgatcgatatgaaagattgtcgaatagtagc
acacggccagaaaaggcagactacatgacgcctataaaagaaactactgaaacagatgtg
gtacctataatccagacacctaaggaacaaataaggacagaagataagaaatcgggggat
aatacagaaacacaaactcaattaacaagcacaaccattcaaagttctccatttctcaca
caacctgaaccacaagcagaaaagcttttacaaactgcagaacattcggaaaagagtaaa
gagcattacccaacgatcatacctcccttcactaaaataaaaaatcaaccgcctgtcatt
attgaaaacccacttagtaataatttaagagcgaagtttttatccgaaatttcgccccca
ttattccaatataacaccttttataactacaaccaagaattgaaaatgagttctctattg
aaaaaaatccatagggtatcccgcaacgaaaacaagaacccaattgttgacttcaagaag
acgggtgatttatattgtatacgcggagaattaggcgaaggaggttatgccactgtatat
ctagcagaatctagtcaaggacatctgcgagcgttgaaagtagaaaaacctgcaagtgta
tgggaatattacataatgagccaagtggagtttaggttgaggaagagcacaatattaaag
tcaataatcaacgctagtgctttacacttgttccttgatgagagctaccttgttttaaac
tacgccagtcaaggtacggtcttggatttaattaatttacaacgggaaaaggcaattgac
ggcaacggaataatggatgaatatttgtgcatgtttatcactgtcgagctaatgaaagta
cttgaaaagatacatgaagtgggaataatacatggcgatttgaaaccagataactgcatg
atcagattagaaaaaccaggcgaacccctgggtgctcattatatgcgcaatggagaggat
ggctgggaaaacaagggaatctatttaatagatttcggtagatcatttgatatgacactg
ttaccacctggaacgaaattcaaatcaaattggaaggctgatcagcaagattgctgggaa
atgcgtgcgggcaagccatggagttatgaagcggattattatggattagcaggcgtcata
cattcgatgctttttggaaaattcatagaaacaatccagctgcagaatggacgatgcaaa
ttgaagaacccattcaaaaggtattggaaaaaagaaatatggggcgttatatttgattta
ctgttaaatagcggtcaagcttccaatcaagctttgccgatgactgaaaagattgttgaa
ataaggaatttgatagaaagccatctggaacagcacgcagaaaatcacttaagaaacgta
attctaagcattgaagaggagttatcacattttcaatataaggggaaaccgtcaaggaga
ttttag

DBGET integrated database retrieval system