KEGG   Saccharomyces cerevisiae (budding yeast): YGR233CHelp
Entry
YGR233C           CDS       T00005                                 

Gene name
PHO81, VAC6
Definition
Pho81p
Orthology
K06653  
CDK inhibitor PHO81
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YGR233C (PHO81)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:complement(954674..958210)
Genome map
AA seq 1178 aa AA seqDB search
MKFGKYLEARQLELAEYNSHFIDYKALKKLIKQLAIPTLKASSDLDLHLTLDDIDEKIIH
QRLQENKAAFFFKLERELEKVNGYYLARESDLRIKFNILHSKYKDYKINGKLNSNQATSF
KNLYAAFKKFQKDLRNLEQYVELNKTGFSKALKKWDKRSQSHDKDFYLATVVSIQPIFTR
DGPLKLNDETLHILLELNDIDNNNRRADIQSSTFTNDDDDDNNTSNNNKHNNNNNNNNNN
NNNNNNNNILHNNYELTTSKISENQLEHLFQASSSSLDMEMEIENWYKEILNIATVKDVQ
RKHALLRNFRETKIFTYLLQNSSESFHKNVFSLLKECLTTLFLLLVASPLDDNSLHIFYK
SNQDHIDLSYCDEDDQVFSRKNVFHEAASCPEKSRLFILDEALTTSKLSKETVQKLLNAQ
DIHSRVPLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLT
IGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKN
KSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAV
RSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNLPSAPLNEIN
SQSSTQRLNTIDLTPNDDKFDLDIQDSIPDFALPPPIIPLRKYGHNFLEKKIFIKLKLRP
GLESIKLTQDNGIIMSSSPGRITLSSNLPEIIPRNVILPVRSGEINNFCKDISETNDEED
DDEISEDHDDGEIIFQVDSIDDFSMDFEIFPSFGTRIIAKTTAMPFLFKKVAINSIATMN
LPLFDTRLNNIGSLTLDYQIIFPYPGNPLKIINYEPYWKSTGSDLMTSSKDGNFVTSSSL
NGSFISVLVCALNDETIVAAPKPYVEFKGTKILLNDLTKEQLEKVVDYDFGKIDGSFDEV
TLKQYLSSRVVPLRSLLEVIPGSAQLVIRVYFPTDKEIDTIPIKISPFININQFIDKLLL
IIFEHERFLRHSGSGSMRQIVFSSCNWEACSILNWKQPNFPVLLQMKNLLRDSTTGKFVG
DTPNCLKELAVNPQKMSYLNTELINIHTMVQFAMNNNLLGVTLPYEVLKICPSLARIIKQ
NGLLLIASVGENDQIPADGGYSGIYYACELLFENNIDM
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcggcaagtatttggaagccaggcagttggaactggcggagtacaacagccat
tttattgattataaggctctaaagaaacttatcaaacaattggccattcccacgctaaag
gctagttcagatttagatttgcatttaacattagatgacatcgacgaaaaaattatacat
cagagactgcaagaaaataaagctgcctttttttttaaactagagagggagctggaaaaa
gtaaatggttattatttggcgagagagtccgatttaagaataaaattcaatatattacac
tcaaaatataaagattataagataaatggtaagctaaactcaaaccaagctacctcattt
aaaaacttatatgcggctttcaaaaagtttcaaaaggatcttagaaatttggagcagtat
gttgagttaaataaaacgggattttcaaaagctctgaagaaatgggacaagagatctcaa
tctcacgataaagatttttaccttgctactgttgtttccattcaaccaatttttaccaga
gatgggccactaaaattaaacgatgaaactttacatattctcttagagctgaatgatatt
gacaacaacaatagaagggcagacatacaatccagtacgtttactaatgacgatgatgac
gacaataataccagcaacaataataaacacaataataataataacaataataataacaac
aacaacaacaacaataataataacatattacacaataattatgaattaacaacatcaaag
atttcggaaaaccaacttgaacatctttttcaagcatcttcctcctccttggacatggag
atggaaatcgaaaactggtataaggaaattttgaatatagccacggtgaaagatgttcaa
agaaagcatgcactactaagaaacttcagagaaaccaagatattcacatatctgctacaa
aattcctcagaatcttttcataaaaatgtcttttctttgttgaaggagtgcttaacgacg
ctgtttttattactggtggctagtcctttggacgataactctctgcatattttctataaa
agcaatcaggatcatattgatctgtcatattgtgacgaagatgatcaagtattttcacga
aaaaacgtatttcacgaggctgcaagttgtccagaaaaatcacgcttatttattctagat
gaggctttaacaacatcaaagttatctaaagaaacagtacaaaaactactgaatgcccaa
gatatacattcgcgggtgccgctacattatgctgcagagctaggaaaactggaatttgtt
cactcgttgctaatcaccaatcttttagaggacgttgatcccattgatagtgattctaag
acacccttggttttggctatcactaacaaccacatagatgttgttagggatctgctgact
attggtggtgcgaacgcatcacccattgaaaagccaattctggattatagtaagaatgta
atcagctctactaaagtccagttcgatcctttaaatgttgcttgtaaatttaataatcat
gacgccgccaagttacttttagaaattcggagtaagcaaaatgctgataatgccaagaac
aaaagttcacaacacttgtgtcaaccgcttttcaaaaagaactcaacaggtttatgcact
cttcatatagtggcaaaaattggcggcgatccacaattaattcaactattgatacgttat
ggggcggatcccaacgaaattgatgggtttaataaatggacgcccattttttacgctgtt
cgttcaggtcattctgaagttattactgaactattgaaacataatgcacgtctggatatt
gaagatgacaacggccattcgccacttttttacgccttatgggagagccacgttgatgtt
ttgaatgcacttttacaaagaccattaaatttgccatctgcacccctgaatgaaataaat
tcgcagtctagtacgcaacgccttaatacaatagatttaaccccaaatgatgacaaattt
gatttagacattcaagatagcattccggattttgctttaccaccgccaatcattccacta
aggaaatatggtcataattttttggagaaaaaaattttcatcaaattaaagttgaggcca
ggtctcgagtctatcaagttgactcaggataacggcattattatgtcatcatcaccaggc
agaattactttatcctcaaacttacctgaaataataccgcgaaatgttattttacctgtt
agatctggcgaaattaataacttttgtaaggatatcagtgaaacaaatgatgaagaagat
gatgatgaaattagtgaagatcatgatgatggagagataattttccaagtagattcaatc
gacgatttttcaatggatttcgagatatttccttcatttggcacaaggataattgccaaa
acaacggcaatgccattccttttcaagaaggtggcaataaatagtattgcaaccatgaat
ttacccttattcgacacaagactaaataatattggatctctcactttggattaccaaatt
atttttccttatccgggaaatccactgaaaatcataaattatgagccgtattggaaatct
acaggaagtgatttaatgacctctagtaaagacggtaattttgttacttcttcatcgttg
aatggcagttttattagtgtattagtttgcgctctgaatgatgaaaccatagtggctgcg
ccaaaaccatacgttgaattcaaaggcacgaagattctgttaaatgatttaacgaaagaa
caattggaaaaggtagtggattatgacttcggtaaaattgatggaagcttcgatgaagta
acattgaaacaatacttatcttcgagagtggtgcctctcagaagcctactagaagttatt
cccgggtcagcccagctggtaattcgtgtatattttcctacagataaggaaattgacaca
attcccatcaaaatatcgccatttataaatatcaatcaattcattgataagcttttacta
atcattttcgagcatgaacgttttttgcgtcacagcggaagtgggagtatgcgccaaata
gttttcagttcatgcaattgggaagcttgctcgatccttaactggaaacaacccaatttt
ccggttttgttgcaaatgaaaaatctactcagagattcaaccacaggcaaatttgtaggt
gatactcctaattgtttaaaggaactggccgtaaatcctcaaaaaatgtcgtatttaaac
acggaactaataaacatacatacaatggttcaatttgctatgaacaataatttgttaggt
gtaacgcttccatatgaagtactgaagatatgcccgtcgttggctaggatcatcaaacaa
aacggactactgttgattgcatcggtcggggaaaatgaccaaataccagctgatggaggt
tacagcgggatctactacgcttgtgagttgctttttgagaataatattgatatgtaa

DBGET integrated database retrieval system