KEGG   Saccharomyces cerevisiae (budding yeast): YGR240CHelp
Entry
YGR240C           CDS       T00005                                 

Gene name
PFK1
Definition
6-phosphofructokinase subunit alpha (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YGR240C (PFK1)
   01230 Biosynthesis of amino acids
    YGR240C (PFK1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YGR240C (PFK1)
   00030 Pentose phosphate pathway
    YGR240C (PFK1)
   00051 Fructose and mannose metabolism
    YGR240C (PFK1)
   00052 Galactose metabolism
    YGR240C (PFK1)
  Energy metabolism
   00680 Methane metabolism
    YGR240C (PFK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     YGR240C (PFK1)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YGR240C (PFK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VII:complement(970771..973734)
Genome map
AA seq 987 aa AA seqDB search
MQSQDSCYGVAFRSIITNDEALFKKTIHFYHTLGFATVKDFNKFKHGENSLLSSGTSQDS
LREVWLESFKLSEVDASGFRIPQQEATNKAQSQGALLKIRLVMSAPIDETFDTNETATIT
YFSTDLNKIVEKFPKQAEKLSDTLVFLKDPMGNNITFSGLANATDSAPTSKDAFLEATSE
DEIISRASSDASDLLRQTLGSSQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGCDVFA
VYEGYEGLLRGGKYLKKMAWEDVRGWLSEGGTLIGTARSMEFRKREGRRQAAGNLISQGI
DALVVCGGDGSLTGADLFRHEWPSLVDELVAEGRFTKEEVAPYKNLSIVGLVGSIDNDMS
GTDSTIGAYSALERICEMVDYIDATAKSHSRAFVVEVMGRHCGWLALMAGIATGADYIFI
PERAVPHGKWQDELKEVCQRHRSKGRRNNTIIVAEGALDDQLNPVTANDVKDALIELGLD
TKVTILGHVQRGGTAVAHDRWLATLQGVDAVKAVLEFTPETPSPLIGILENKIIRMPLVE
SVKLTKSVATAIENKDFDKAISLRDTEFIELYENFLSTTVKDDGSELLPVSDRLNIGIVH
VGAPSAALNAATRAATLYCLSHGHKPYAIMNGFSGLIQTGEVKELSWIDVENWHNLGGSE
IGTNRSVASEDLGTIAYYFQKNKLDGLIILGGFEGFRSLKQLRDGRTQHPIFNIPMCLIP
ATVSNNVPGTEYSLGVDTCLNALVNYTDDIKQSASATRRRVFVCEVQGGHSGYIASFTGL
ITGAVSVYTPEKKIDLASIREDITLLKENFRHDKGENRNGKLLVRNEQASSVYSTQLLAD
IISEASKGKFGVRTAIPGHVQQGGVPSSKDRVTASRFAVKCIKFIEQWNKKNEASPNTDA
KVLRFKFDTHGEKVPTVEHEDDSAAVICVNGSHVSFKPIANLWENETNVELRKGFEVHWA
EYNKIGDILSGRLKLRAEVAALAAENK
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctcaagattcatgctacggtgttgcattcagatctatcatcacaaatgatgaa
gctttattcaagaagaccattcacttttatcacactctaggatttgcaactgtgaaagat
ttcaacaaattcaaacatggtgaaaatagcttactatcttcagggacttcccaagattcc
ttgagagaagtttggttagaatctttcaagttgagtgaggttgatgcttctgggttccgt
ataccacaacaagaagctactaacaaggctcaaagtcaaggtgctctattaaagattcgt
ttagtgatgtctgctccaatcgatgaaactttcgacaccaacgaaaccgccacaatcact
tatttctctactgatttgaacaagattgtcgagaaattcccaaaacaagccgaaaaattg
tccgataccttagtgtttttgaaagatccaatgggcaacaacatcaccttctcaggctta
gctaatgcaaccgattccgctccaacttccaaagatgctttcttagaagctacctccgaa
gacgaaatcatctctagagcttcttccgatgcttctgacttactaagacaaacattgggc
tcttctcaaaagaagaagaagattgctgtcatgacttctggtggtgattctccaggtatg
aatgccgctgttcgtgccgttgttcgtacaggtatacatttcggctgtgatgtttttgct
gtttacgaaggttacgaaggtttactaagaggcggtaaatatttaaagaaaatggcttgg
gaagatgtcagaggttggttaagtgaaggtggtactttgattggtactgctcgttctatg
gaattcagaaagcgtgagggtcgtagacaagctgcaggcaatttaatttcgcaaggtatt
gacgctttggttgtttgtggtggtgatggttctttaaccggtgctgatcttttcagacac
gaatggccatctttggttgatgaattggttgcagaaggtagattcactaaagaagaagtc
gccccatacaagaatttgtccattgttggtcttgtcggttccatcgataatgatatgtct
ggtactgactctaccattggtgcttattctgctttggaaagaatctgtgaaatggttgac
tacattgatgccaccgctaaatcccactcccgtgcctttgttgttgaagttatgggtaga
cattgtggttggttggccttgatggctggtattgctaccggtgccgattacatttttatt
ccagaaagagctgttcctcacggaaaatggcaggacgaattgaaggaagtgtgccaaaga
cacagaagtaagggtagaagaaataacacaattattgtcgctgaaggtgctttagatgat
caattaaaccctgttactgccaatgacgtcaaagatgctttgattgaattgggtctagac
accaaggtaaccattctaggtcacgttcaaagaggtggtacagctgttgctcatgacaga
tggttagctactctacaaggtgtcgatgctgttaaggccgttctggaatttacccctgaa
actccttctccattaattggtattttagaaaacaagataattagaatgccattggttgaa
tctgtgaagttgactaaatctgttgccactgccattgaaaacaaagatttcgataaggca
atttctttaagagacacagaatttattgaactttacgaaaacttcttatccactaccgtt
aaagatgatggttccgaattattgccagtatctgacagactaaacattggtattgtccat
gttggtgccccatctgctgctttgaacgctgccacccgtgccgcaactctatactgtttg
tctcacggccataaaccatacgctatcatgaatggtttcagtggattgattcaaaccggt
gaagtgaaggaactatcatggattgatgtcgaaaactggcataacttgggtggttccgaa
atcggtacgaacagatctgttgcttcagaagatttgggtaccattgcttactacttccaa
aagaacaagctagacggtttgattattcttggtggttttgaaggtttcaggtccttgaag
caattgcgtgacggtagaacccaacacccaatctttaacattccaatgtgtttgattcca
gccactgtttctaacaacgttccaggtactgaatactcacttggtgttgatacctgtttg
aacgcattagtcaattacactgatgacatcaaacagagtgcttctgcgacaagaagaaga
gtcttcgtctgtgaagtccaaggtggtcactctggttacatcgcttctttcactggttta
atcactggtgctgtttcagtgtacactccagaaaagaagatcgacttagcttctatcaga
gaagatataactctattaaaagagaactttcgtcacgacaaaggtgaaaacagaaacggt
aagctattggttagaaacgaacaagcttctagcgtatatagcactcaattgttggctgac
atcatctctgaagcaagcaagggtaagtttggtgttagaactgctatcccaggccatgtt
caacaaggtggtgttccatcttctaaagaccgtgtcaccgcttccagatttgctgtcaaa
tgtatcaagtttatcgaacaatggaacaagaaaaatgaagcttctccaaacactgacgct
aaggttttgagattcaagttcgatactcacggtgaaaaggtaccaactgttgagcacgaa
gatgactctgctgctgttatctgtgttaatggttctcacgtttccttcaagccaattgct
aacctttgggaaaacgaaaccaacgttgaattaagaaagggttttgaagttcactgggct
gaatacaacaagattggtgacatcctgtccggtagattaaagttgagagctgaggtagcc
gctttagccgctgaaaacaaatga

DBGET integrated database retrieval system