KEGG   Saccharomyces cerevisiae (budding yeast): YGR240CHelp
Entry
YGR240C           CDS       T00005                                 

Gene name
PFK1
Definition
6-phosphofructokinase subunit alpha (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:sce01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sce01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sce00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sce00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sce00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sce00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:sce00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VII:complement(970771..973734)
Genome map
AA seq 987 aa AA seqDB search
MQSQDSCYGVAFRSIITNDEALFKKTIHFYHTLGFATVKDFNKFKHGENSLLSSGTSQDS
LREVWLESFKLSEVDASGFRIPQQEATNKAQSQGALLKIRLVMSAPIDETFDTNETATIT
YFSTDLNKIVEKFPKQAEKLSDTLVFLKDPMGNNITFSGLANATDSAPTSKDAFLEATSE
DEIISRASSDASDLLRQTLGSSQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGCDVFA
VYEGYEGLLRGGKYLKKMAWEDVRGWLSEGGTLIGTARSMEFRKREGRRQAAGNLISQGI
DALVVCGGDGSLTGADLFRHEWPSLVDELVAEGRFTKEEVAPYKNLSIVGLVGSIDNDMS
GTDSTIGAYSALERICEMVDYIDATAKSHSRAFVVEVMGRHCGWLALMAGIATGADYIFI
PERAVPHGKWQDELKEVCQRHRSKGRRNNTIIVAEGALDDQLNPVTANDVKDALIELGLD
TKVTILGHVQRGGTAVAHDRWLATLQGVDAVKAVLEFTPETPSPLIGILENKIIRMPLVE
SVKLTKSVATAIENKDFDKAISLRDTEFIELYENFLSTTVKDDGSELLPVSDRLNIGIVH
VGAPSAALNAATRAATLYCLSHGHKPYAIMNGFSGLIQTGEVKELSWIDVENWHNLGGSE
IGTNRSVASEDLGTIAYYFQKNKLDGLIILGGFEGFRSLKQLRDGRTQHPIFNIPMCLIP
ATVSNNVPGTEYSLGVDTCLNALVNYTDDIKQSASATRRRVFVCEVQGGHSGYIASFTGL
ITGAVSVYTPEKKIDLASIREDITLLKENFRHDKGENRNGKLLVRNEQASSVYSTQLLAD
IISEASKGKFGVRTAIPGHVQQGGVPSSKDRVTASRFAVKCIKFIEQWNKKNEASPNTDA
KVLRFKFDTHGEKVPTVEHEDDSAAVICVNGSHVSFKPIANLWENETNVELRKGFEVHWA
EYNKIGDILSGRLKLRAEVAALAAENK
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctcaagattcatgctacggtgttgcattcagatctatcatcacaaatgatgaa
gctttattcaagaagaccattcacttttatcacactctaggatttgcaactgtgaaagat
ttcaacaaattcaaacatggtgaaaatagcttactatcttcagggacttcccaagattcc
ttgagagaagtttggttagaatctttcaagttgagtgaggttgatgcttctgggttccgt
ataccacaacaagaagctactaacaaggctcaaagtcaaggtgctctattaaagattcgt
ttagtgatgtctgctccaatcgatgaaactttcgacaccaacgaaaccgccacaatcact
tatttctctactgatttgaacaagattgtcgagaaattcccaaaacaagccgaaaaattg
tccgataccttagtgtttttgaaagatccaatgggcaacaacatcaccttctcaggctta
gctaatgcaaccgattccgctccaacttccaaagatgctttcttagaagctacctccgaa
gacgaaatcatctctagagcttcttccgatgcttctgacttactaagacaaacattgggc
tcttctcaaaagaagaagaagattgctgtcatgacttctggtggtgattctccaggtatg
aatgccgctgttcgtgccgttgttcgtacaggtatacatttcggctgtgatgtttttgct
gtttacgaaggttacgaaggtttactaagaggcggtaaatatttaaagaaaatggcttgg
gaagatgtcagaggttggttaagtgaaggtggtactttgattggtactgctcgttctatg
gaattcagaaagcgtgagggtcgtagacaagctgcaggcaatttaatttcgcaaggtatt
gacgctttggttgtttgtggtggtgatggttctttaaccggtgctgatcttttcagacac
gaatggccatctttggttgatgaattggttgcagaaggtagattcactaaagaagaagtc
gccccatacaagaatttgtccattgttggtcttgtcggttccatcgataatgatatgtct
ggtactgactctaccattggtgcttattctgctttggaaagaatctgtgaaatggttgac
tacattgatgccaccgctaaatcccactcccgtgcctttgttgttgaagttatgggtaga
cattgtggttggttggccttgatggctggtattgctaccggtgccgattacatttttatt
ccagaaagagctgttcctcacggaaaatggcaggacgaattgaaggaagtgtgccaaaga
cacagaagtaagggtagaagaaataacacaattattgtcgctgaaggtgctttagatgat
caattaaaccctgttactgccaatgacgtcaaagatgctttgattgaattgggtctagac
accaaggtaaccattctaggtcacgttcaaagaggtggtacagctgttgctcatgacaga
tggttagctactctacaaggtgtcgatgctgttaaggccgttctggaatttacccctgaa
actccttctccattaattggtattttagaaaacaagataattagaatgccattggttgaa
tctgtgaagttgactaaatctgttgccactgccattgaaaacaaagatttcgataaggca
atttctttaagagacacagaatttattgaactttacgaaaacttcttatccactaccgtt
aaagatgatggttccgaattattgccagtatctgacagactaaacattggtattgtccat
gttggtgccccatctgctgctttgaacgctgccacccgtgccgcaactctatactgtttg
tctcacggccataaaccatacgctatcatgaatggtttcagtggattgattcaaaccggt
gaagtgaaggaactatcatggattgatgtcgaaaactggcataacttgggtggttccgaa
atcggtacgaacagatctgttgcttcagaagatttgggtaccattgcttactacttccaa
aagaacaagctagacggtttgattattcttggtggttttgaaggtttcaggtccttgaag
caattgcgtgacggtagaacccaacacccaatctttaacattccaatgtgtttgattcca
gccactgtttctaacaacgttccaggtactgaatactcacttggtgttgatacctgtttg
aacgcattagtcaattacactgatgacatcaaacagagtgcttctgcgacaagaagaaga
gtcttcgtctgtgaagtccaaggtggtcactctggttacatcgcttctttcactggttta
atcactggtgctgtttcagtgtacactccagaaaagaagatcgacttagcttctatcaga
gaagatataactctattaaaagagaactttcgtcacgacaaaggtgaaaacagaaacggt
aagctattggttagaaacgaacaagcttctagcgtatatagcactcaattgttggctgac
atcatctctgaagcaagcaagggtaagtttggtgttagaactgctatcccaggccatgtt
caacaaggtggtgttccatcttctaaagaccgtgtcaccgcttccagatttgctgtcaaa
tgtatcaagtttatcgaacaatggaacaagaaaaatgaagcttctccaaacactgacgct
aaggttttgagattcaagttcgatactcacggtgaaaaggtaccaactgttgagcacgaa
gatgactctgctgctgttatctgtgttaatggttctcacgtttccttcaagccaattgct
aacctttgggaaaacgaaaccaacgttgaattaagaaagggttttgaagttcactgggct
gaatacaacaagattggtgacatcctgtccggtagattaaagttgagagctgaggtagcc
gctttagccgctgaaaacaaatga

DBGET integrated database retrieval system