KEGG   Saccharomyces cerevisiae (budding yeast): YGR240CHelp
Entry
YGR240C           CDS       T00005                                 

Gene name
PFK1
Definition
(RefSeq) 6-phosphofructokinase subunit alpha
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00010  Glycolysis / Gluconeogenesis
sce00030  Pentose phosphate pathway
sce00051  Fructose and mannose metabolism
sce00052  Galactose metabolism
sce00680  Methane metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
sce01230  Biosynthesis of amino acids
sce03018  RNA degradation
Module
sce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YGR240C (PFK1)
   00030 Pentose phosphate pathway
    YGR240C (PFK1)
   00051 Fructose and mannose metabolism
    YGR240C (PFK1)
   00052 Galactose metabolism
    YGR240C (PFK1)
  Energy metabolism
   00680 Methane metabolism
    YGR240C (PFK1)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    YGR240C (PFK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     YGR240C (PFK1)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YGR240C (PFK1)
Messenger RNA biogenesis [BR:sce03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     YGR240C (PFK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 853155
NCBI-ProteinID: NP_011756
SGD: S000003472
UniProt: P16861
Structure
PDB: 

Jmol
Position
VII:complement(970771..973734)
Genome map
AA seq 987 aa AA seqDB search
MQSQDSCYGVAFRSIITNDEALFKKTIHFYHTLGFATVKDFNKFKHGENSLLSSGTSQDS
LREVWLESFKLSEVDASGFRIPQQEATNKAQSQGALLKIRLVMSAPIDETFDTNETATIT
YFSTDLNKIVEKFPKQAEKLSDTLVFLKDPMGNNITFSGLANATDSAPTSKDAFLEATSE
DEIISRASSDASDLLRQTLGSSQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGCDVFA
VYEGYEGLLRGGKYLKKMAWEDVRGWLSEGGTLIGTARSMEFRKREGRRQAAGNLISQGI
DALVVCGGDGSLTGADLFRHEWPSLVDELVAEGRFTKEEVAPYKNLSIVGLVGSIDNDMS
GTDSTIGAYSALERICEMVDYIDATAKSHSRAFVVEVMGRHCGWLALMAGIATGADYIFI
PERAVPHGKWQDELKEVCQRHRSKGRRNNTIIVAEGALDDQLNPVTANDVKDALIELGLD
TKVTILGHVQRGGTAVAHDRWLATLQGVDAVKAVLEFTPETPSPLIGILENKIIRMPLVE
SVKLTKSVATAIENKDFDKAISLRDTEFIELYENFLSTTVKDDGSELLPVSDRLNIGIVH
VGAPSAALNAATRAATLYCLSHGHKPYAIMNGFSGLIQTGEVKELSWIDVENWHNLGGSE
IGTNRSVASEDLGTIAYYFQKNKLDGLIILGGFEGFRSLKQLRDGRTQHPIFNIPMCLIP
ATVSNNVPGTEYSLGVDTCLNALVNYTDDIKQSASATRRRVFVCEVQGGHSGYIASFTGL
ITGAVSVYTPEKKIDLASIREDITLLKENFRHDKGENRNGKLLVRNEQASSVYSTQLLAD
IISEASKGKFGVRTAIPGHVQQGGVPSSKDRVTASRFAVKCIKFIEQWNKKNEASPNTDA
KVLRFKFDTHGEKVPTVEHEDDSAAVICVNGSHVSFKPIANLWENETNVELRKGFEVHWA
EYNKIGDILSGRLKLRAEVAALAAENK
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctcaagattcatgctacggtgttgcattcagatctatcatcacaaatgatgaa
gctttattcaagaagaccattcacttttatcacactctaggatttgcaactgtgaaagat
ttcaacaaattcaaacatggtgaaaatagcttactatcttcagggacttcccaagattcc
ttgagagaagtttggttagaatctttcaagttgagtgaggttgatgcttctgggttccgt
ataccacaacaagaagctactaacaaggctcaaagtcaaggtgctctattaaagattcgt
ttagtgatgtctgctccaatcgatgaaactttcgacaccaacgaaaccgccacaatcact
tatttctctactgatttgaacaagattgtcgagaaattcccaaaacaagccgaaaaattg
tccgataccttagtgtttttgaaagatccaatgggcaacaacatcaccttctcaggctta
gctaatgcaaccgattccgctccaacttccaaagatgctttcttagaagctacctccgaa
gacgaaatcatctctagagcttcttccgatgcttctgacttactaagacaaacattgggc
tcttctcaaaagaagaagaagattgctgtcatgacttctggtggtgattctccaggtatg
aatgccgctgttcgtgccgttgttcgtacaggtatacatttcggctgtgatgtttttgct
gtttacgaaggttacgaaggtttactaagaggcggtaaatatttaaagaaaatggcttgg
gaagatgtcagaggttggttaagtgaaggtggtactttgattggtactgctcgttctatg
gaattcagaaagcgtgagggtcgtagacaagctgcaggcaatttaatttcgcaaggtatt
gacgctttggttgtttgtggtggtgatggttctttaaccggtgctgatcttttcagacac
gaatggccatctttggttgatgaattggttgcagaaggtagattcactaaagaagaagtc
gccccatacaagaatttgtccattgttggtcttgtcggttccatcgataatgatatgtct
ggtactgactctaccattggtgcttattctgctttggaaagaatctgtgaaatggttgac
tacattgatgccaccgctaaatcccactcccgtgcctttgttgttgaagttatgggtaga
cattgtggttggttggccttgatggctggtattgctaccggtgccgattacatttttatt
ccagaaagagctgttcctcacggaaaatggcaggacgaattgaaggaagtgtgccaaaga
cacagaagtaagggtagaagaaataacacaattattgtcgctgaaggtgctttagatgat
caattaaaccctgttactgccaatgacgtcaaagatgctttgattgaattgggtctagac
accaaggtaaccattctaggtcacgttcaaagaggtggtacagctgttgctcatgacaga
tggttagctactctacaaggtgtcgatgctgttaaggccgttctggaatttacccctgaa
actccttctccattaattggtattttagaaaacaagataattagaatgccattggttgaa
tctgtgaagttgactaaatctgttgccactgccattgaaaacaaagatttcgataaggca
atttctttaagagacacagaatttattgaactttacgaaaacttcttatccactaccgtt
aaagatgatggttccgaattattgccagtatctgacagactaaacattggtattgtccat
gttggtgccccatctgctgctttgaacgctgccacccgtgccgcaactctatactgtttg
tctcacggccataaaccatacgctatcatgaatggtttcagtggattgattcaaaccggt
gaagtgaaggaactatcatggattgatgtcgaaaactggcataacttgggtggttccgaa
atcggtacgaacagatctgttgcttcagaagatttgggtaccattgcttactacttccaa
aagaacaagctagacggtttgattattcttggtggttttgaaggtttcaggtccttgaag
caattgcgtgacggtagaacccaacacccaatctttaacattccaatgtgtttgattcca
gccactgtttctaacaacgttccaggtactgaatactcacttggtgttgatacctgtttg
aacgcattagtcaattacactgatgacatcaaacagagtgcttctgcgacaagaagaaga
gtcttcgtctgtgaagtccaaggtggtcactctggttacatcgcttctttcactggttta
atcactggtgctgtttcagtgtacactccagaaaagaagatcgacttagcttctatcaga
gaagatataactctattaaaagagaactttcgtcacgacaaaggtgaaaacagaaacggt
aagctattggttagaaacgaacaagcttctagcgtatatagcactcaattgttggctgac
atcatctctgaagcaagcaagggtaagtttggtgttagaactgctatcccaggccatgtt
caacaaggtggtgttccatcttctaaagaccgtgtcaccgcttccagatttgctgtcaaa
tgtatcaagtttatcgaacaatggaacaagaaaaatgaagcttctccaaacactgacgct
aaggttttgagattcaagttcgatactcacggtgaaaaggtaccaactgttgagcacgaa
gatgactctgctgctgttatctgtgttaatggttctcacgtttccttcaagccaattgct
aacctttgggaaaacgaaaccaacgttgaattaagaaagggttttgaagttcactgggct
gaatacaacaagattggtgacatcctgtccggtagattaaagttgagagctgaggtagcc
gctttagccgctgaaaacaaatga

DBGET integrated database retrieval system