KEGG   Saccharomyces cerevisiae (budding yeast): YGR252WHelp
Entry
YGR252W           CDS       T00005                                 

Gene name
GCN5, AAS104, ADA4, SWI9
Definition
Gcn5p (EC:2.3.1.48)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     YGR252W (GCN5)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     YGR252W (GCN5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VII:996869..998188
Genome map
AA seq 439 aa AA seqDB search
MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKENKGKFEKETER
IGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKIEFRVVNNDNTKENMMVLTGL
KNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITYRPFDKREFAEIVFCAIS
STEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGY
IKDYEGGTLMQCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI
KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAWPFLQPVNKEE
VPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENTSYYKYANRL
EKFFNNKVKEIPEYSHLID
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggtcacaaaacatcagattgaagaggatcacttggatggagctacgacggatcccgaa
gttaaacgggtaaaattagaaaacaacgttgaagaaatacaacctgagcaggctgagacc
aataaacaagagggcaccgataaagagaataaaggaaagttcgagaaagaaactgagaga
ataggaggatctgaagtggttacagatgtggaaaaaggaattgtcaaatttgaatttgat
ggtgttgaatacacattcaaagagagacccagtgtcgtagaggaaaatgaaggtaaaatt
gagtttagggtggtgaataatgataatactaaagaaaacatgatggtcctaactggatta
aaaaacatttttcaaaagcaattaccaaaaatgcccaaagaatacattgccaggttagtc
tatgatcgaagtcatctttccatggctgtcattaggaagccattgactgtcgtaggtggc
ataacatatcgacctttcgataagagagaattcgcagaaattgttttctgtgccatcagt
tcgacggaacaggtacgcggttatggtgcgcatctaatgaatcacttaaaagactatgtt
agaaatacctcgaacataaaatattttttgacatatgcagataattacgctattggatac
tttaaaaagcaaggcttcactaaagaaatcacgttggataaaagtatatggatgggatat
attaaagattatgaaggtggtacgctgatgcaatgttctatgttaccaagaatacgatat
ttggacgcaggtaagattctattattacaagaagcggccctgcgaagaaaaataagaacg
atttcgaaatcgcatattgtaaggcctggtttagagcaattcaaagacttaaacaatatc
aaaccgattgatccaatgactattcctggcttgaaagaagccggctggactcccgagatg
gatgcgttggcacaacgtcccaagcgtggtccacacgatgcagcaatacagaatatactc
acagagctacaaaatcatgcagcagcttggcccttcttacaacccgttaataaagaggag
gtccccgactattatgattttatcaaagagccaatggacttgagcaccatggaaataaaa
ttagagagcaacaaatatcagaagatggaagacttcatatatgatgccagattggtgttt
aacaattgccgaatgtacaatggcgagaatacgtcgtattacaagtatgctaataggcta
gagaaattcttcaataataaagtaaaagaaatacctgaatattctcaccttattgattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system