KEGG   Saccharomyces cerevisiae (budding yeast): YGR252WHelp
Entry
YGR252W           CDS       T00005                                 

Gene name
GCN5, AAS104, ADA4, KAT2, SWI9
Definition
(RefSeq) histone acetyltransferase GCN5 (EC:2.3.1.48)
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     YGR252W (GCN5)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     YGR252W (GCN5)
Chromosome [BR:sce03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    YGR252W (GCN5)
   HAT complexes
    PCAF complex
     YGR252W (GCN5)
    STAGA complex
     YGR252W (GCN5)
    TFTC complex
     YGR252W (GCN5)
    SAGA complex
     YGR252W (GCN5)
    SLIK complex
     YGR252W (GCN5)
    ADA-HAT complex
     YGR252W (GCN5)
    HAT-A2 complex
     YGR252W (GCN5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
VII:996869..998188
Genome map
AA seq 439 aa AA seqDB search
MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKENKGKFEKETER
IGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKIEFRVVNNDNTKENMMVLTGL
KNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITYRPFDKREFAEIVFCAIS
STEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGY
IKDYEGGTLMQCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI
KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAWPFLQPVNKEE
VPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENTSYYKYANRL
EKFFNNKVKEIPEYSHLID
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggtcacaaaacatcagattgaagaggatcacttggatggagctacgacggatcccgaa
gttaaacgggtaaaattagaaaacaacgttgaagaaatacaacctgagcaggctgagacc
aataaacaagagggcaccgataaagagaataaaggaaagttcgagaaagaaactgagaga
ataggaggatctgaagtggttacagatgtggaaaaaggaattgtcaaatttgaatttgat
ggtgttgaatacacattcaaagagagacccagtgtcgtagaggaaaatgaaggtaaaatt
gagtttagggtggtgaataatgataatactaaagaaaacatgatggtcctaactggatta
aaaaacatttttcaaaagcaattaccaaaaatgcccaaagaatacattgccaggttagtc
tatgatcgaagtcatctttccatggctgtcattaggaagccattgactgtcgtaggtggc
ataacatatcgacctttcgataagagagaattcgcagaaattgttttctgtgccatcagt
tcgacggaacaggtacgcggttatggtgcgcatctaatgaatcacttaaaagactatgtt
agaaatacctcgaacataaaatattttttgacatatgcagataattacgctattggatac
tttaaaaagcaaggcttcactaaagaaatcacgttggataaaagtatatggatgggatat
attaaagattatgaaggtggtacgctgatgcaatgttctatgttaccaagaatacgatat
ttggacgcaggtaagattctattattacaagaagcggccctgcgaagaaaaataagaacg
atttcgaaatcgcatattgtaaggcctggtttagagcaattcaaagacttaaacaatatc
aaaccgattgatccaatgactattcctggcttgaaagaagccggctggactcccgagatg
gatgcgttggcacaacgtcccaagcgtggtccacacgatgcagcaatacagaatatactc
acagagctacaaaatcatgcagcagcttggcccttcttacaacccgttaataaagaggag
gtccccgactattatgattttatcaaagagccaatggacttgagcaccatggaaataaaa
ttagagagcaacaaatatcagaagatggaagacttcatatatgatgccagattggtgttt
aacaattgccgaatgtacaatggcgagaatacgtcgtattacaagtatgctaataggcta
gagaaattcttcaataataaagtaaaagaaatacctgaatattctcaccttattgattaa

DBGET integrated database retrieval system