KEGG   Saccharomyces cerevisiae (budding yeast): YGR260WHelp
Entry
YGR260W           CDS       T00005                                 

Gene name
TNA1
Definition
(RefSeq) Tna1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Position
VII:1012485..1014089
Genome map
AA seq 534 aa AA seqDB search
MSNKFTMESPKHLVDDVLFISPTNDGSEEKPTEVTFQEDEGHDASLHNRSHDKKSELATE
REIMATTTDDDGIPSPSHPMEKRVLRKMDIYLIPLMGMLYFLSNLDKSNIGNAEVAGLSK
DIHLVGTQYNTCVTVFFATYVLFDPIGTNLLKIMGPPLMMSICLTCFGAISLGTAWVKNY
AQLIVVRLLLGAFEGMIYPAINMYLSVCYRREQYALRFAFVFSAACLSSSFGGLIAYGCS
KISGSLKDWQYIYIVEGCISLGFVPFYAFGLSKNLEDSWFFNKEEKEYISERYKTMNTFD
PDEKFEWFQVWQAVKDVKTWASAVALFGIDLTTFGLTVFLPIIITSMGFTNVRAQLMTVP
IYFLTAIVFFICAVWSDRIKLRSPFILGACLTTSIGIAIVLGSQVHGVRYFGVYILCMGI
YVNAACNCLWLSGNTGNYFKRATALGINLFFGSGSGLVSGQIFVAKDKPRYIKGLSISLA
FQVFSIFMTVVQIFLYKRENDKKKAIIDRCNELGEPIPYDERLSDKNPEFKYMY
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaaatttacaatggagtcacctaagcatttggtggatgatgtgcttttcata
tcacccaccaatgatggatcagaagaaaagcctacggaagtcacgttccaggaagatgaa
ggccatgacgctagcttgcataatcgcagccatgacaagaagtcggaacttgccaccgaa
cgggaaattatggctactaccacggatgatgacggcatcccctccccttcccatccaatg
gaaaagcgtgtcttgcgcaaaatggatatatacttgattcctcttatggggatgctatat
ttcctttctaacctggataaatcgaatattggtaacgcagaagttgcaggtctatccaag
gatatccaccttgtaggaacgcaatataacacatgtgtcacagtttttttcgcgacgtat
gttcttttcgaccccataggtactaaccttctgaaaattatgggtccgccattaatgatg
agtatctgtttgacctgtttcggtgctatttcgctcggaactgcttgggttaagaattat
gctcaattgatcgttgtcagactactactgggtgcctttgaaggtatgatttatcccgct
attaacatgtacctttcagtctgctatagaagagaacaatatgctctgaggttcgctttt
gtcttcagtgcagcctgtttgtcttcatcttttggtgggctgattgcttatggttgttcc
aaaatcagcggttctctaaaggactggcaatacatttacattgtcgaaggttgtatctct
ttggggttcgtaccattctatgccttcgggttgagcaaaaatttggaggattcgtggttt
ttcaataaggaggaaaaagagtacatttccgaaagatacaagactatgaacacttttgac
ccggacgaaaaatttgaatggttccaagtgtggcaagcagttaaggatgtcaagacttgg
gctagtgctgtggcattattcggtatcgatttgactacttttggtctaacagtcttcttg
ccgatcatcattaccagtatggggttcactaatgtcagagctcaattaatgaccgtgccc
atctatttccttacagcaattgtgttcttcatttgtgccgtttggtctgatcgtataaag
ttgagatctccattcatcctgggtgcttgtctgacgacttcgataggcatagctatcgtc
cttggttctcaagttcatggtgtgagatattttggcgtttacattctttgtatgggtatt
tacgttaatgctgcctgtaactgtttatggttaagtggtaacactggtaattacttcaag
agagccaccgctttaggaattaatctatttttcgggtctggttcagggttggtctctggt
caaatttttgttgccaaagacaagccaagatatatcaaagggctgtcgattagtctggcc
tttcaagtcttctccatatttatgacggttgtgcaaattttcctatacaagagggaaaac
gataaaaagaaagcaataatagatcgctgtaatgaattgggagagcctattccatacgac
gaaaggttaagcgacaaaaaccctgagtttaagtacatgtattag

DBGET integrated database retrieval system