KEGG   Saccharomyces cerevisiae (budding yeast): YGR267CHelp
Entry
YGR267C           CDS       T00005                                 

Gene name
FOL2
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YGR267C (FOL2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     YGR267C (FOL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VII:complement(1025004..1025735)
Genome map
AA seq 243 aa AA seqDB search
MHNIQLVQEIERHETPLNIRPTSPYTLNPPVERDGFSWPSVGTRQRAEETEEEEKERIQR
ISGAIKTILTELGEDVNREGLLDTPQRYAKAMLYFTKGYQTNIMDDVIKNAVFEEDHDEM
VIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKKVIGLSKLARLAEMYARRLQVQERLTKQI
AMALSDILKPLGVAVVMEASHMCMVSRGIQKTGSSTVTSCMLGGFRAHKTREEFLTLLGR
RSI
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcataacatccaattagtgcaagagatagaaagacatgaaaccccgttaaacattaga
cctacctctccatacactttaaaccctcctgtcgagagagatgggttttcttggccaagt
gtgggtacaagacaacgtgcagaggaaactgaagaggaggaaaaggaacgaattcaacgc
atttcaggcgctatcaagacaattttgaccgaactgggtgaagatgtcaacagagaaggt
ctactagatactccacaaagatacgctaaagccatgctttatttcactaaaggttaccaa
acgaacattatggacgatgtcattaagaatgctgtctttgaagaagatcatgatgaaatg
gttattgttcgtgatattgaaatttactcgttatgtgaacatcatttggtgccatttttc
ggcaaggttcatatcgggtatataccaaataaaaaagtcatcgggttaagtaagttggcc
agattggcagaaatgtatgcgagaaggctccaagttcaagaaagacttacaaagcaaatt
gcaatggccctaagtgatattctaaaaccattaggtgtagccgttgttatggaagcttct
catatgtgcatggtttcaagaggcattcaaaaaacgggatcttctacggtaacttcttgt
atgcttggagggtttagggctcataaaacaagagaagagtttttaactcttttaggaaga
agaagtatttga

  All links  
No link information was found.   
DBGET integrated database retrieval system