KEGG   Saccharomyces cerevisiae (budding yeast): YHL003CHelp
Entry
YHL003C           CDS       T00005                                 

Gene name
LAG1
Definition
sphingosine N-acyltransferase LAG1 (EC:2.3.1.24)
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sce00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
VIII:complement(100648..101883)
Genome map
AA seq 411 aa AA seqDB search
MTSATDKSIDRLVVNAKTRRRNSSVGKIDLGDTVPGFAAMPESAASKNEAKKRMKALTGD
SKKDSDLLWKVWFSYREMNYRHSWLTPFFILVCVYSAYFLSGNRTESNPLHMFVAISYQV
DGTDSYAKGIKDLSFVFFYMIFFTFLREFLMDVVIRPFTVYLNVTSEHRQKRMLEQMYAI
FYCGVSGPFGLYIMYHSDLWLFKTKPMYRTYPVITNPFLFKIFYLGQAAFWAQQACVLVL
QLEKPRKDYKELVFHHIVTLLLIWSSYVFHFTKMGLAIYITMDVSDFFLSLSKTLNYLNS
VFTPFVFGLFVFFWIYLRHVVNIRILWSVLTEFRHEGNYVLNFATQQYKCWISLPIVFVL
IAALQLVNLYWLFLILRILYRLIWQGIQKDERSDSDSDESAENEESKEKCE
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagctacggacaaatctatcgataggttagttgttaatgcaaaaacaagaaga
cgaaactcttccgtgggtaaaattgatttaggtgatacagttcctggctttgcagccatg
cctgaaagtgctgcctctaaaaatgaggccaaaaaaaggatgaaagccttgactggtgac
tctaaaaaggatagtgacctactgtggaaggtttggttttcatatagagaaatgaattac
cgtcatagttggttgacaccattcttcatacttgtatgcgtgtatagcgcgtacttttta
tctgggaatagaacagaatcaaacccgctgcacatgttcgtagccatatcatatcaagtt
gatggcacagactcatatgcaaaaggtatcaaagatttgagttttgtgtttttctacatg
attttcttcacatttttacgtgagtttttgatggatgttgtaattcgaccattcacggta
tacctaaatgttacttccgagcatcgtcaaaagcgtatgctagaacaaatgtatgccata
ttttattgcggagtttcagggccctttggtctttatattatgtaccatagtgatttgtgg
ttgttcaagacaaaaccaatgtacagaacatatcctgttataaccaatccgttcttgttt
aagatattttacttgggtcaagcggcattttgggcgcaacaggcttgtgttcttgttcta
caattagaaaagccaagaaaggattacaaggaattggtttttcatcacattgtgacatta
ttattaatttggtcatcatatgttttccattttaccaaaatgggattggctatctatatt
actatggatgtgtcagattttttcctttctttgtctaagacattaaactatctgaattct
gtatttactccctttgtgttcggcttgttcgtgttcttttggatctatctgcgccatgtc
gtgaatatcagaatattatggtcagtcttaacagaattccgtcatgaaggtaattatgtg
ttgaattttgccacacaacaatacaaatgttggatttcgttgccaattgtatttgtacta
attgctgcgttacaattagttaacctgtattggctgtttttaattcttagaatcttgtac
agattgatatggcaaggtatccaaaaggacgaaagaagtgacagtgattctgatgagagc
gctgaaaatgaagaatctaaggaaaagtgtgaataa

DBGET integrated database retrieval system